KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_18840Help
Entry
APA42C_18840      CDS       T01818                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA42C_18840
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APA42C_18840
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APA42C_18840
Enzymes [BR:apw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APA42C_18840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1955898..1957025
Genome map
AA seq 375 aa AA seqDB search
MTGYTSPSLTNAKRLVVKIGSALVVDPEKQAPRQEWLASVAADIAYLRKQGTAVTVVSSG
AIALARHTLGLAGGALRLAEKQAAAAVGQISLAQAWSNALSAHGLIAAQLLLTPEDTEDR
KRYLNARATLNTLLEMGCVPVINENDTVATAEIRFGDNDRLAARVAQMTDSDQLVLLSDI
DGLYTADPRTNPDAQHLPVIETLTPEIEAMGGEPPPGYSSGGMRTKLLAAGIATRSGCAM
AIALGKTPHPLRSLLEGGRCSWFLPQDCAHTARKQWIAGSLTPAGEIMVDDGAVTALQQG
KSLLPAGVLGVKGDFSQGDLVEIINTDGIVLAHGLAAYDADDARRIAGHRSTELTDILGW
HGRDEIIHRDDLVMI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacaccagcccctcccttaccaatgccaaacggcttgttgttaaaataggt
agcgcgctggtggtggacccagaaaaacaggctcctcgtcaggaatggctggccagtgtg
gcggcagatattgcgtatctgcgcaaacagggcacggctgttactgttgtatcttctggc
gctattgcacttgcccggcacacattgggtttggctggtggcgcgctccgtttggcagaa
aaacaggcagccgctgctgtagggcagatcagtctggcgcaggcatggagcaatgctctt
tcggcccacggccttattgccgcccagcttctgctgaccccggaagatacagaagaccgc
aaacgctacctgaatgcacgcgcaacgctgaataccctgctggaaatggggtgcgttccc
gtaattaacgagaacgataccgttgccacagccgaaattcgttttggcgataatgacagg
ctggcagcccgcgttgcacaaatgacggactcggaccagcttgtgctgctgtctgatatt
gatggcctctacacggctgacccacgcacaaacccggatgcacagcatctgcccgtgatt
gaaacccttaccccggaaattgaagccatggggggggaacctccgccgggttattcttct
gggggtatgcgcaccaagctgttggctgcgggcattgctacacgctcgggctgtgccatg
gctattgccttgggtaaaacgccccacccgctccgctctttgctggaaggtgggcgctgc
tcatggttcttgccgcaagattgcgcccatacagcccgcaagcagtggattgcaggcagc
ctgacaccagcaggtgaaattatggtggatgatggtgccgtaaccgcattacagcagggc
aaatctcttttgccagcaggtgtgcttggggtgaagggtgatttctctcagggtgatctg
gtagaaattatcaatacggatggcatcgtgctggctcatgggcttgccgcctatgatgca
gacgatgcccggcgcattgcaggccaccgctccaccgagcttacagatattttgggatgg
cacggacgggacgagatcatccatcgtgatgacctcgtcatgatctag

DBGET integrated database retrieval system