KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_19190Help
Entry
APA42C_19190      CDS       T01818                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:apw00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998011..1998640
Genome map
AA seq 209 aa AA seqDB search
MPLQSAPFPLAFIPGKTDALIVVDVQNDFLPDGALPVPKGHAIVPVINRLAHLPFGLIVT
SQDWHPSDHVSFKTTHQNGLWPPHCVANTPGADFPQDLHLPEQTLHLFKGAQSGQDSYSA
FGAKTQSGLLLDAVLKQHGITRVFVCGLALEYCVQATALDAQKAGYTTVLLTDATQGLEA
DPTPTLTACQAKGILLYSGLQLHIPSPTR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcaatccgcgcctttccctcttgcctttataccgggcaaaacggatgcgctg
attgtggtggatgtgcagaacgattttctgccagatggcgccctgcctgtgcccaaaggc
catgccattgtgcctgttatcaacagattggcacatttaccgtttgggttgatcgtgacc
tcgcaggactggcacccatccgatcatgtttctttcaaaaccactcatcaaaacggtctg
tggcctccgcattgtgtagccaacacacccggcgctgattttccccaagatttacacctg
cctgaacagaccctgcacctgtttaaaggcgcacaatccggtcaggacagctactctgct
tttggggccaaaacacagtcgggcctgttgctggatgctgttttaaaacagcatggcatc
acgcgtgtttttgtgtgtggcttggcattggaatactgcgtgcaggccacagcactagat
gcgcaaaaagccggatatacaaccgtgcttcttacagatgctacccaaggcctagaggct
gaccctacccccactttaacggcctgtcaggcaaaaggcattttgctgtattctggttta
caattacacataccttctccaacacgctga

DBGET integrated database retrieval system