KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_26260Help
Entry
APA42C_26260      CDS       T01818                                 

Gene name
ruvA
Definition
Holliday junction resolvase RusA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753073..2753681)
Genome map
AA seq 202 aa AA seqDB search
MIAFLCGLVIQVDLGSCVIDVNGVGYLVAASTRTLAALPNPPEKARLLIETVVREDAILL
YGFMESAEREWFRLLTSVQGVGAKVALGILSTLSPGELVAALMTSDKASLTRAPGVGGRL
AERILTELRDKAGKMPGGGGGITIPAMATPAGSIEADALMALAGLGFRRAEAAPVVRKVM
DAHGAAATLDLVIRDSLKDLAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtttttatgcggattggtcattcaggttgatctgggaagctgcgttatagac
gtaaacggtgtgggctatcttgttgcagcctctacacgcactttggcggctttgccgaac
ccaccagaaaaagcccggcttctgatagaaaccgttgtgcgcgaagatgccattcttctg
tacggttttatggaaagtgcagaacgtgaatggttccggctgttaacaagcgtgcagggg
gtaggggcaaaggttgctcttggtattctctccactctgtcaccgggagaactggtggcc
gcgctgatgacatcagataaagccagtctcacacgtgcgccgggtgtaggcggtaggttg
gcagaacggattctgacagagctgcgtgataaagccggcaaaatgcccggtggtggtggc
ggtattaccattccggccatggcaacacctgctggcagtatagaagcagatgcgcttatg
gcgctggctggtttgggtttccgccgggcagaagcagcgcctgtggtgcggaaagtcatg
gatgcacatggggcggctgccacactggatttggtgattcgtgacagcctgaaagacctt
gcccgatga

DBGET integrated database retrieval system