KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_26260Help
Entry
APA42C_26260      CDS       T01818                                 

Gene name
ruvA
Definition
Holliday junction resolvase RusA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APA42C_26260 (ruvA)
Enzymes [BR:apw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     APA42C_26260 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2753073..2753681)
Genome map
AA seq 202 aa AA seqDB search
MIAFLCGLVIQVDLGSCVIDVNGVGYLVAASTRTLAALPNPPEKARLLIETVVREDAILL
YGFMESAEREWFRLLTSVQGVGAKVALGILSTLSPGELVAALMTSDKASLTRAPGVGGRL
AERILTELRDKAGKMPGGGGGITIPAMATPAGSIEADALMALAGLGFRRAEAAPVVRKVM
DAHGAAATLDLVIRDSLKDLAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtttttatgcggattggtcattcaggttgatctgggaagctgcgttatagac
gtaaacggtgtgggctatcttgttgcagcctctacacgcactttggcggctttgccgaac
ccaccagaaaaagcccggcttctgatagaaaccgttgtgcgcgaagatgccattcttctg
tacggttttatggaaagtgcagaacgtgaatggttccggctgttaacaagcgtgcagggg
gtaggggcaaaggttgctcttggtattctctccactctgtcaccgggagaactggtggcc
gcgctgatgacatcagataaagccagtctcacacgtgcgccgggtgtaggcggtaggttg
gcagaacggattctgacagagctgcgtgataaagccggcaaaatgcccggtggtggtggc
ggtattaccattccggccatggcaacacctgctggcagtatagaagcagatgcgcttatg
gcgctggctggtttgggtttccgccgggcagaagcagcgcctgtggtgcggaaagtcatg
gatgcacatggggcggctgccacactggatttggtgattcgtgacagcctgaaagacctt
gcccgatga

DBGET integrated database retrieval system