KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_41760Help
Entry
APA42C_41760      CDS       T01818                                 

Gene name
recD_traA
Definition
DNA helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APA42C_41760 (recD_traA)
Enzymes [BR:apw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     APA42C_41760 (recD_traA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAPA42C_011:complement(184771..186990)
Genome map
AA seq 739 aa AA seqDB search
MTSAVVGEQCQTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFV
QMSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAV
FDLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLHSNGVGTSRAVRIFKTYG
QDAVRLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMDEGHC
GLPVGELLTSTAELLEVAAPLIETALALELEAGDVVADSVGETSCIFLAGLYRAEQSIAE
RLRACAVGRPPWPEIDAEKAMTWVEGKTGLAMAPSQQEAVRLALRSKVLVITGGPGVGKT
TLVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPGNGSFKRDDTN
PLTCDLLVVDEASMVDVLLMRSLLRALPDSASLLIVGDVDQLPSVGPGQVLADIIGSDAV
PVVRLTEVFRQAAQSRIITNAHRINEGKMPELSAEEGSDFYFVEAAEPEVGLRKLLAVVK
DRIPARFGLDPVRDVQVLCPMNRGGLGARSLNIELQQALNPAGDVKVERFGWTYGPGDKV
MQIANDYDRDVFNGDLGVIDKIDVEEGELTVLFDGREVVYGFGELDELVLAYATTIHKSQ
GSEYPVVVIPLVTQHYTMLARNLLYTGVTRGRKLVVLVGQKKALAIAVRNQGGRLRWSKL
RDWLVGTSGTGHLSRLKKP
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgccgtggttggagaacaatgccaaacggaagcgctggccggcctcgtggag
cgggtgacgttccacaatgccgagaacggtttctgcgtcctgcgggtgaaggtgcggggg
cagcgcgatctggtcactgtcgtcggccatgccgccatgatctcggcgggtgagttcgtg
cagatgtcggggcgctggttcaacgaccacacccacggcttgcagttcaaggcggagttc
ctcaaggccagtccgccgaccacggtcgaaggcatagagcgctatctcggctcgggcatg
atccggggcattggtcccgtctatgccaaaaaactggtgaaagcgttcggcgaggccgtg
ttcgacctgatcgagcaggaaccgcatcgcctgcgggaagtgacaggcattggtcccaag
cgggccgaacggattgtcggtggctgggcagaccagaaggtgatccgcgagatcatgctg
ttcctgcacagcaacggcgtcggcacgtcgcgggcggtacggatcttcaagacctacggg
caggatgcggtcagactgatcagcgagaacccctatcggttggcgaaggacatccggggc
atcggcttcaaaaccgccgaccagatcgcccggaagatggggatcgcgcctgatgccatg
atccgggtgagggccgggatctcctatgcccttggtgaggcgatggatgaagggcattgc
ggcctcccggtcggtgaactcctgaccagcaccgccgaactgctggaggtcgccgcccct
ctgatcgaaacagccctcgcgctggagctggaagcgggagacgtggtcgctgatagcgtg
ggagagacgagttgcattttcttggctggtctctatcgcgcggagcagagcatcgccgag
cgattgcgcgcctgcgccgtgggtcggccgccctggccggagatcgatgctgaaaaggcc
atgacttgggtggaaggcaagaccggacttgccatggcgcccagccagcaggaagcggtg
cgccttgcactgcgtagcaaggtgctggtgatcacgggtggtcctggcgtgggcaagacc
acgctggtcaacgccattctgaagatcgtgactgccaagggcacagacgtgcaactttgc
gcgccgaccggccgggcggcgaagcgcctgtcggaaagcacggggctggaaggcaagacc
atccatagactgctggagacggatccgggcaatggcagtttcaaacgggacgataccaac
ccgctgacctgcgacctgctggttgtggacgaggccagcatggtcgacgtgctgctgatg
cgctccctgctgcgcgcgttacctgacagcgcgtctctgctgatcgtcggcgacgtggac
cagttgccttctgtcggaccggggcaggtgctggccgatatcattggctccgatgctgtc
cctgtggtgcgcctgaccgaggtgttccgccaggcggcacagagccggatcatcaccaac
gcgcaccggatcaacgaagggaagatgccggagctgagcgcggaagagggatcggatttc
tatttcgtggaggcggctgagcccgaggtcggactgcgcaagttgctggccgtggtgaag
gaccgcatcccggcgcggttcgggctggacccggtccgcgacgtgcaggtgctctgcccg
atgaaccgaggtgggctgggcgcacggtcgctgaatatcgagttgcagcaggcgctgaac
ccggcaggcgacgtgaaggtcgagcggttcggctggacctacggtcccggcgacaaggtg
atgcagatcgccaacgattatgaccgggacgtcttcaacggggatctcggcgttatcgac
aagatcgatgtggaagagggcgaactgacggtcttattcgatggacgggaggtcgtttac
ggcttcggcgagttggacgaactggtgctggcctacgcgacgaccattcacaagagccag
ggctcggaatatccggtagtggtcatcccgctggtgacgcagcattatacgatgctggcg
cggaacctgctttataccggtgttacacgggggcggaagctcgtcgtgctggtcgggcag
aagaaggctctggccatagctgtgcgaaatcagggcggaaggctacgttggtcaaaactg
agagactggctggtgggtacgtcaggtacaggtcatctatcccgcctaaagaaaccttaa

DBGET integrated database retrieval system