KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_03620Help
Entry
APA26_03620       CDS       T01816                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APA26_03620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA26_03620
   00620 Pyruvate metabolism
    APA26_03620
   00640 Propanoate metabolism
    APA26_03620
  Energy metabolism
   00680 Methane metabolism
    APA26_03620
Enzymes [BR:apx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APA26_03620
Lipid biosynthesis proteins [BR:apx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APA26_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374509..376497
Genome map
AA seq 662 aa AA seqDB search
MSENITILPTQYADYPALMPPAELAAMQRYARRDPDGFWLQQARRVHWHRKPRRGFTGSF
TGDVSISWFEDGLINASVCCIDKHLTDKADQIALISHREGRAEAEKITYAMLHERVCRLS
NALVHLGVEEGHRVAICLPMISEAVVAMLACARIGAVHVVLFGGFSAEGIAERIIDSGAV
AVITASESMRGNKIVPFKAIMDEALCKAGAESGVRAVLVVRTSDAPVPMLPGRDYDFHDF
VDSFEADFVPVVMRAEAPLFMLYTSGSTGKPKAVVHATGGYMVWAAYTMDMVYHHQPGDV
LWCTADVAWITGHTSVVYGPLANGGTTMISDSLPSYPAPGRWLDLIDEHKVTMLFTAPTA
VRAMMADGDDVVNARNLESLRLLGVAGEPISPDAWLWYHDVVGKKRCPVVDTWWQTETAG
IVLGPVPGVQPLKPGSASTPLPGLEMVIADTQGRPVQGPAEGSLCIARSWPGQARTIWKD
HARFCQTYFGMVPGHYFTGDGARRDADGYYWITGRMDDVINIAGHRLGTAEVEDALAADH
RIVESAAVGIPHPVKGQALAVFVIQRQNVATELTEKGISRLISGMLGRYATPEAVYLVPD
LPRTRSGKIVRRLLRKIASGEMDNLGDLSSLNDPSIVRMLCDRVWSHMAFDEESAPRTQA
RA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaacatcactatcctgcctacacagtatgcagattacccggctctgatgcca
cctgcggaactggccgccatgcagcgctatgcacgccgagacccggatggtttttggctg
caacaggcccggcgtgtgcactggcaccgcaagcctaggcgaggctttacgggcagcttt
acgggtgatgtgtccataagctggtttgaagatggccttatcaacgcatccgtatgctgt
attgataagcatctgacagacaaggctgatcagattgcccttatcagccaccgtgaaggc
cgggccgaggcagaaaaaattacatatgccatgctgcatgaacgggtttgccgcctgtct
aacgcgctggtgcatttgggggtggaggaagggcaccgcgttgccatttgcctgcccatg
atttcagaagccgtggtggccatgctggcctgtgcgcgtattggcgcggtgcatgtggtg
ctgtttggtggtttttcggcagaaggtattgcagaacgtattatagatagcggcgcagtt
gcggtaattaccgccagcgaaagcatgcgcggcaacaagatcgtgccctttaaagcgatt
atggatgaagccctgtgcaaggcaggtgcagaaagtggcgtgcgggctgttctagttgtg
cgcacgtctgatgcacctgttcccatgctgcctggtagggattacgattttcatgatttt
gtagattcgtttgaggcagattttgtgcccgttgtcatgcgggcagaagcaccattattt
atgctctacacatctggcagcacaggcaagcccaaagcagttgtgcatgccactggtggc
tatatggtgtgggcagcttacactatggacatggtgtaccatcatcaacctggtgatgtg
ctgtggtgcacggcagatgtggcatggataaccgggcatacatccgttgtgtatggcccg
ctggccaatggcggaaccaccatgatttccgatagcctgccttcataccccgctccgggc
agatggttggatctgatagatgagcataaggtgaccatgctgtttaccgcccccacagcc
gtgcgcgccatgatggccgatggtgatgatgtggtgaacgcccgcaatctggagtctctg
cgtttgctgggtgtggcgggggagcccataagcccggatgcgtggctatggtatcacgat
gttgtgggtaaaaagcgttgccccgtggtggatacatggtggcagacagaaaccgccggc
attgtgctggggccagtgccgggtgtgcaaccgcttaaacccggctctgccagcacgccg
ctgccggggttggaaatggtcatagccgatacgcagggcaggccggtgcaggggcctgca
gaaggtagcctgtgcattgcgcgttcatggccggggcaggcccgcacaatctggaaagat
catgctcgcttctgccagacatattttggtatggttccggggcattatttcacgggtgat
ggcgcacggcgagatgccgatggctattactggattacggggcgcatggacgatgttatc
aatattgcagggcaccgtttgggtacagcagaagtggaagatgcgttggcagcagatcat
cgtattgtggaatctgctgcagtgggcatcccgcacccggtaaaggggcaggcgctggcg
gtatttgttatccagcgccagaacgtggctacggaactgacagaaaaaggcataagccgc
cttatctccggtatgttggggcgttatgccacgccagaggccgtttatctggtgccagat
ctgcctcgcacgcgctctggcaagattgtacgccgcctgctgcgcaaaattgccagtggg
gaaatggataatctgggagatctttcatcgctgaatgatccttccatcgtgcgtatgctg
tgtgacagagtatggagccacatggcttttgatgaggaatctgcacctcgcacacaggca
agggcctga

DBGET integrated database retrieval system