KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_05960Help
Entry
APA26_05960       CDS       T01816                                 

Definition
(GenBank) esterase/lipase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx00010  Glycolysis / Gluconeogenesis
apx00020  Citrate cycle (TCA cycle)
apx00620  Pyruvate metabolism
apx01100  Metabolic pathways
apx01110  Biosynthesis of secondary metabolites
apx01120  Microbial metabolism in diverse environments
apx01130  Biosynthesis of antibiotics
apx01200  Carbon metabolism
Module
apx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA26_05960
   00020 Citrate cycle (TCA cycle)
    APA26_05960
   00620 Pyruvate metabolism
    APA26_05960
Enzymes [BR:apx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APA26_05960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl DUF915 Esterase DUF676 Thioesterase Esterase_phd LIDHydrolase Ser_hydrolase Lipase_3 Ndr
Motif
Other DBs
NCBI-ProteinID: BAI10940
Position
614304..615470
Genome map
AA seq 388 aa AA seqDB search
MPNTITALTMPKFGLAMTEGKLASWTVPVDQSVQQGDELADIETTKITSSYESPAAGVLR
KQVAEAGETLPVGALIGVLADAETPDVDIEAFIKNFHAENPQDAAATEDANAGEPKPVTV
GEHTLNVRDVGTHTGTPIVLVHGFGGDISNWLLTQDALAADRRVIAFDLPGHGASSKNVG
TGTLAFLAGVVSELLKTLKIEKAHVVGHSLGGGIALTLLRDHPDQVASLNLLAPAGLGKD
VNSDFISAFVDSESSRDMKAVLQMLVHNKALVGRKMVDAVLRARRLDGARDALHVIAKAC
FPNGHQADDLRPVLAGAETPTQIFWGKEDEILSVSNASGLPDVIPVTVYEETGHLPQLER
ATDVNKAIAVFVKDPEAALSMARMDATA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaccattacagccctcaccatgcccaagttcggtttggccatgacagaaggc
aaactggcatcatggacggtgccagttgaccagagcgtgcagcagggtgatgaactggcg
gatattgaaaccaccaaaattaccagcagttatgaaagccccgccgcaggtgtgttgcgc
aaacaggtggcagaggcgggggaaaccctgcccgtgggcgcactgattggcgtgctggct
gatgccgaaacgcccgatgtggatattgaagcctttatcaagaactttcatgccgaaaac
ccgcaggatgccgccgccacggaggatgccaacgccggagaacccaagccggtaacggtg
ggggaacacacgctgaatgtgcgtgatgtgggcacacatacgggcacgcccattgtgctg
gtgcacggttttggcggagatattagcaactggctgctcacgcaggatgctctggccgca
gacaggcgcgtgattgcgtttgacctgccggggcatggggcttcttccaaaaacgtgggc
acaggcacgctggcgtttttggccggcgtggtgagcgaattgctgaaaaccctgaaaata
gaaaaagcccatgtggtgggccattctctgggtggcggcattgcgctgaccctgctgcga
gaccaccccgatcaggttgccagcctgaaccttctggcccccgccgggttgggcaaggat
gtgaattcagatttcatcagcgcgtttgtggatagtgaaagcagccgcgatatgaaagct
gttttgcaaatgctggtgcataacaaagcccttgtgggccggaagatggtggatgccgtg
ctgcgtgcccgccggttggatggcgcgcgtgatgccctgcacgttattgccaaggcgtgc
ttccccaacgggcatcaggcggatgatttgcgcccggtcttggccggggcggaaacaccc
acccagattttctggggtaaggaagatgaaattctttctgtttccaacgcatccggcctg
ccagatgtcattcccgtaacggtgtatgaagaaacaggccatctgccgcagcttgaacgc
gcaacagatgttaacaaagccattgccgtgtttgtaaaagaccccgaagccgcgctgagc
atggcccggatggacgctacagcctaa

DBGET integrated database retrieval system