KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_08590Help
Entry
APA26_08590       CDS       T01816                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    APA26_08590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA26_08590
  Lipid metabolism
   00071 Fatty acid degradation
    APA26_08590
  Amino acid metabolism
   00350 Tyrosine metabolism
    APA26_08590
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APA26_08590
   00626 Naphthalene degradation
    APA26_08590
Enzymes [BR:apx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APA26_08590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891612..892595)
Genome map
AA seq 327 aa AA seqDB search
MFAMRLHQPKTPLQWEEVPDPVPGPGEIRVKVLACGVCRTDLHVVDGDLTHPKLPIIPGH
EIVGRIDQIGSGVTSLSVGQRVGIPWLGHTCGHCFYCSDHHENLCDHPVFTGYTRDGGYA
TMAVADARFAFPLGEEGSDVEVAPLLCAGLIGWRSLVKTGNAQKVGLYGFGAAAHIIAQV
LVWQKKQVYAFTRPGDAKTQAFARELGATWAGGSDELPPEQLDATIIFAPVGALVPAALK
TLRKGGRVVCAGIHMSEIPAFSYDILWEEREIVSVANLTRQDGLDFLSIAPKIGIHTTTT
TYALKDANKALDDLRHGRFDGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccatgcgtctgcaccagcccaaaacgcccctgcaatgggaggaagtgccagac
ccggtgcccgggcccggtgaaattcgggtaaaagtgctggcctgcggtgtatgccgcaca
gatttgcacgtggtggatggagaccttacacaccccaagctgcccattattcccggccac
gaaattgtcgggcggattgaccaaattggctctggcgttacctctttatctgttgggcag
cgcgtgggtattccgtggcttgggcacacatgcggacactgcttttattgcagcgatcat
catgaaaacctgtgtgaccatcccgtatttaccggttacacgcgagatggcggctacgcc
acaatggcagtagccgatgcccgctttgccttcccactaggggaagaaggatcagacgta
gaagtagcgccgctcttgtgtgccgggcttattggctggcgttccttggtaaaaaccgga
aacgcgcaaaaagtggggctgtatggctttggggctgcggcccatattattgcgcaggtt
ctggtctggcagaaaaagcaggtttacgcttttacccgccccggtgatgcaaaaacccaa
gcctttgcgcgtgagttaggggcaacatgggcaggaggttctgacgaactgccgccagaa
caactggatgccaccattatttttgcacctgtaggcgccttagtgccggcagccttaaaa
accctgcgtaaaggcgggcgcgtggtgtgcgcaggtatccatatgagcgaaatacctgct
ttttcttacgatatcttgtgggaagaacgtgaaattgtttccgttgccaatctcacccgt
caggatgggttggattttctgtccatcgcgcccaaaattggcattcacaccaccacaacc
acatatgccctaaaggacgccaacaaggcgctggatgatttacggcatgggcggtttgat
ggtgctgccgtgctggtgccctaa

DBGET integrated database retrieval system