KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_11170Help
Entry
APA26_11170       CDS       T01816                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
apx00040  Pentose and glucuronate interconversions
apx00052  Galactose metabolism
apx00500  Starch and sucrose metabolism
apx00520  Amino sugar and nucleotide sugar metabolism
apx01100  Metabolic pathways
apx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APA26_11170
   00052 Galactose metabolism
    APA26_11170
   00500 Starch and sucrose metabolism
    APA26_11170
   00520 Amino sugar and nucleotide sugar metabolism
    APA26_11170
Enzymes [BR:apx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APA26_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAI11461
Position
1178324..1179214
Genome map
AA seq 296 aa AA seqDB search
MSKPKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDEAREAGIEEFCLIT
GRGKDSLIDYFDIAYELEDTLRERNKIDCLKALEPSSIEAGSLIAVRQQEPLGLGHAIWC
ARSFIGDDPFAILLPDDIVQAAPGKGCLKQLADAYNETGGSVVAVTEVPREQTNRYGILD
TGKDDGRLVEVKGLVEKPKPEDAPSNLSIIGRYVLTPEVMPYLSKLEKGAGGEVQLTDAM
AKTIGQVPFHGLRYEGTRYDCGNKLGFLEAQVAFALERPDLADGVKEFLKKYTDKI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaacccaagcctttacgtaaagcagtcctgcctgttgcgggattgggaacgcgc
tttctgcccgcaaccaaggccatgccaaaggaaatgctgcctgttgttgacaggccgctg
atccagtatgcgattgatgaagcgcgtgaagccgggattgaagagttctgcctgattaca
ggccgcggtaaggactctcttattgattactttgatattgcttacgagctggaagatacg
ctcagagagcgcaacaagattgattgcctgaaagcgctggaacccagctctattgaagca
ggctctcttattgcagtgcgtcagcaggaaccgctgggccttgggcacgctatctggtgc
gcacgttcctttattggggatgatccgttcgccatcctgctgcccgatgatatcgtgcag
gctgcacccggcaagggctgcctgaagcagttggccgatgcgtataatgaaacaggcggt
agcgttgtggcggtaacagaagtgccgcgtgaacagacaaaccgttacggtattctggac
acaggcaaggatgatggccgccttgtggaagtaaaaggcctggttgaaaagccaaagccg
gaagatgcaccttccaatctgtccatcattggccgttatgtgctgacaccagaagttatg
ccttacctttccaagctggaaaaaggtgcaggtggtgaagtgcagcttacagatgccatg
gcaaaaaccattggtcaggtgcctttccacggcctgcgttatgaaggcacccgctatgat
tgcggcaacaagcttggcttccttgaagcgcaggtagcctttgctctggaacgtcctgat
cttgctgatggcgtgaaggaatttctgaaaaagtacacagataaaatctga

DBGET integrated database retrieval system