KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_12440Help
Entry
APA26_12440       CDS       T01816                                 

Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1306499..1307176)
Genome map
AA seq 225 aa AA seqDB search
MPYPKDKDMETARNLMVDDQLRPSEITNLSLLSVMRELPRECCVMPDQHSVAYADITLPL
GQGRVLPQPLLTARLVQAVLPVEKARVLVVGAATGYTAALFAALGANVTALESNTRLAEL
GQHFCQQEALSVSWVIAPLSEGATGNAPYDVIYFDGAILRFPAFCAAQLAASGTMAGVMV
SPNTLAKAFVAMREPESASSFIVTNLFETQLPLLPDLAAPITFEF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatccaaaagataaagatatggaaacagcacgtaacctaatggtggacgatcag
cttcgcccttcagaaattacaaacctctcattactgtcggtcatgcgggaattgccccgt
gaatgttgtgttatgcccgatcagcactctgttgcttatgcagatatcacgctgcctctg
gggcaggggcgtgttttgccacaaccgctgcttacagcacgcctcgtgcaggctgttctg
ccggtagaaaaggcgcgggttcttgttgtgggggcagccaccggatacacggcagcactt
tttgctgctcttggcgccaatgttactgcgcttgaatcaaacacacgtctggccgaactg
gggcaacacttttgccagcaagaagcccttagcgtttcatgggtcatcgcccctctcagc
gagggcgcaacaggcaatgctccttatgatgttatttattttgatggtgccattctgcgt
ttccctgccttttgtgctgctcaacttgcagcgtccggcactatggctggcgtaatggtc
tctcccaacacattggcaaaagcctttgtcgccatgagagagccggaaagtgcctccagt
tttattgtcactaacctttttgaaacacagcttcccttactgccagatcttgccgcaccc
attacttttgaattctag

DBGET integrated database retrieval system