KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_12550Help
Entry
APA26_12550       CDS       T01816                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apx00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1314989..1316488)
Genome map
AA seq 499 aa AA seqDB search
MSKQDCVLAIDQGTTSTRSIVFDRDAQELAAAREEFAQHYPKAGWVEHCPEDIWKDVVST
ARAALEKSGAADRVAGIGITNQRETIVVWERATGKPIHRAIVWQDRRTANVCQKLRDEGA
ETLVRERTGLLIDPYFSATKLAWLLDNVPQARERAEKGELAFGTIDSFILWRLTGGKVHA
TDVTNASRTMLFDIHRQQWDEDLLRLFRVPAALLPEVKDSSCIYGETVPELFGRPIPIAG
IAGDQQAAVVGQACFTPGMAKATYGTGCFLLLNTGDKPVTSRNRMLTTIAYRINGKTTYA
LEGSIFVAGAAIKWLRDGLHLITHASQTDDMATRVPDSHGVYMVPGFVGLGAPHWDPDAR
GLICGLTLDSSAAHIARAALESVAYQTLDLVTAMMQDGGGTTDSIRVDGGMSANDWYCQF
LADMLQAKVERPRNVETTALGAGFLAGIATGVWDSEQTVASEWARGSLFEPKMENEQRRT
MIAGWHQAVKRTLSTYTGG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaagactgtgtcctggctattgatcagggaacgacatcaacacgcagcatt
gtctttgatcgtgatgcgcaggaactcgctgccgccagagaggagtttgcacagcattac
cccaaggctggctgggtagaacactgcccggaagatatctggaaagatgttgtaagcacc
gcgcgcgcagcgctggaaaaatctggcgcagcagaccgggttgcaggcattggcattacc
aaccagcgcgaaaccattgtggtgtgggaacgcgctaccggcaagcctatccatcgcgct
attgtctggcaggatcggcgcacggccaatgtgtgtcagaaactgcgggatgaaggcgca
gaaacactggtgcgcgaacgcaccggccttttgattgacccatatttttctgccaccaag
cttgcatggctgctggataacgtgcctcaggcccgcgaacgtgcagaaaagggtgaactt
gcttttggcaccattgattccttcattctgtggcgcctgacaggcggtaaggtgcatgca
acggatgtaaccaacgcatcccgcaccatgctgtttgatatccaccgccaacagtgggat
gaagaccttctgcgtcttttccgcgtacctgcggcacttctcccagaagtgaaggatagt
agctgcatttatggtgaaaccgtgccggaactgttcggtcggcctattcctattgcaggt
attgcgggggatcagcaggccgctgtagtggggcaagcatgttttacacccggcatggcc
aaggccacctacggcacaggctgctttttgctgctgaatacgggggataaacccgtaaca
tcacgcaaccgaatgctcaccaccatagcctatcgtatcaatggcaaaaccacctatgcg
ctggaaggctccatttttgtggccggtgcggccatcaaatggctgcgcgatgggctgcat
ctgattacccacgcctctcaaaccgatgatatggccacccgtgtgccagacagccacggt
gtatacatggtgccgggctttgtaggccttggcgccccacattgggacccggacgcacgc
gggcttatctgcggccttacgctggattcaagtgctgcgcatattgcccgtgcggctctg
gaatccgtggcatatcagacgctcgatctggtaaccgccatgatgcaggatggcggtggc
accacagatagcattcgcgtagatggcggcatgtctgccaatgactggtactgccagttt
cttgcagacatgctgcaggccaaggtggaacgcccgcgcaacgtggaaaccactgctctg
ggcgcaggctttctggcaggcatagcaacaggtgtgtgggatagtgagcagaccgtggct
tctgaatgggcacggggctctctgtttgaaccgaaaatggaaaatgaacagcgccgcacc
atgattgccggatggcatcaggctgttaagcgcaccctcagcacctatacgggcggctga

DBGET integrated database retrieval system