KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_16770Help
Entry
APA26_16770       CDS       T01816                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:apx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:apx00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1820972..1822372
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGNAPVLSFADVLLTGLAEDGGLYLPETWPEFSLPDWESLRGLPYPELAARVLA
PFAAPDIDLETLRGLCAKAYANFDHPAIVPLTQVEDGLFVQELFHGPTLAFKDMAMQVLG
QLFEHVLTQRNDHVTIVGATSGDTGSAAIEACRGRDRLSVIILHPKGRTSEVQRRQMTTV
LDSNVTNLAVEGTFDDCQDLVKALFADLPFRREMHLSAVNSINWARIAAQIPYYVYAALN
FGAPEREVSFAVPTGNFGNILAAWAARKMGLPIKHLCVGSNRNDILTRFLNANDMTIKGV
VPSLSPSMDIQVSSNFERLLFELLGRDSAACARIMTGFRATGHMDVPEEVWENARTVFSG
LALDDEQTEAEIRNLHQKSNYLADPHSAIGIAAGRKFRQPGVPMIAEATAHPAKFPDAMV
AATGIHPALPVHLEDLFEREERYRTVPATAGAIKDAVRAAVLANAP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttccacacgcgggaatgctcccgtcctttcctttgccgatgttctgctt
accggtcttgccgaggatggcggcctgtatctgcccgaaacatggcccgaattctcgctg
cctgattgggaaagcctgcgtggcctgccctatccggaactggctgcccgtgttctggcc
ccgtttgcagcaccggatattgatctggaaacactgcgcggcctgtgcgccaaggcctat
gccaactttgaccacccagccattgtgccgctaacgcaggtggaagatggcctgtttgtg
caggaactgttccacggccccacgctggcgttcaaagacatggccatgcaggtgctcggc
cagctttttgaacacgtactcacccagcggaatgatcacgtaaccattgtaggtgccacc
tctggcgatacaggttccgccgccattgaagcctgccgtgggcgggaccgtctgtctgtt
atcatcctgcaccccaaaggccggacatcggaagtgcagcgccgccagatgacaaccgtg
ctggattccaacgtgaccaatctggccgttgaaggcacgtttgatgactgtcaggacctg
gtaaaggctctgtttgctgatctgcctttccgccgggaaatgcatctttccgccgtcaat
tccatcaactgggcgcgtattgcggctcagatcccttactatgtttatgcggccttgaac
tttggtgccccagagcgtgaagtttcctttgctgtgcctacaggcaactttggcaacatt
cttgctgcttgggctgcacgcaaaatggggctgcctatcaaacatctgtgcgttggttcc
aaccggaacgatattctcacccggttcctgaatgccaatgacatgaccatcaaaggtgtg
gtgcctagcctttcaccttccatggacattcaggtttcttccaactttgaacgtttgctg
tttgagcttctgggtcgtgattctgctgcctgcgcacgtatcatgaccggcttccgcgcc
acggggcatatggatgtgcctgaagaagtgtgggaaaatgctcgcaccgtcttctctggc
cttgcgctggatgatgagcagacggaagcggaaattcgtaacctgcaccagaaatccaat
tatctggcagacccccacagcgccattggcattgctgcgggccgcaagttccgacagccg
ggcgtgcccatgattgcagaagccaccgcgcatccggccaagttccccgatgccatggtg
gcagctacgggtattcatccggcactgcctgtgcatctggaagatctgtttgagcgggaa
gaacgttatcgcactgttccggcaaccgcaggcgcaattaaagatgctgtgcgcgctgcg
gtactggcaaacgctccctaa

DBGET integrated database retrieval system