KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_18410Help
Entry
APA26_18410       CDS       T01816                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APA26_18410
Enzymes [BR:apx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     APA26_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998302..1998913
Genome map
AA seq 203 aa AA seqDB search
MSVPPSDTSQRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVARAYTEFFCGYEIDPA
ALLRRTFSEVEGYDEIVLLRDIRFESHCEHHLAPIIGRAHVAYLPRQRVVGISKLARVVD
AYAKRLQIQERLTAQIANTINDELEPHGVAVIIESSHECMTTRGVHKPGVSMVTSTMLGV
FRENSDTRRELMAMLNRPAACEF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcctccgtctgatacatctcaacgcccaacacaagccgaagcagaacaggct
gtacgcaccctgctacgctgggctggcgataacccggaccgtgaaggcctgcacgatact
cctgcccgtgttgcccgcgcttacaccgaatttttctgtgggtatgaaattgaccccgca
gccctgttacgccgcaccttttccgaagtggaagggtatgatgaaattgtgctgctgcgt
gatatccgctttgaaagccattgtgagcatcatctggcccccattatcgggcgtgcgcat
gttgcctatctgccgcgccagcgcgttgtaggcatttccaaactggcgcgtgtggtggat
gcctacgccaagcgcctgcaaattcaggaacggctcacggcccagattgccaacaccatc
aatgatgaactggaaccgcatggggttgccgttattattgaatcttcccacgaatgcatg
acaacacgcggcgtgcataaacccggtgtttccatggtcaccagcactatgctgggcgtt
tttcgggaaaattcagacacacggcgcgaactgatggcaatgctcaaccgccctgccgcc
tgcgaattctaa

DBGET integrated database retrieval system