KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_19890Help
Entry
APA26_19890       CDS       T01816                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA26_19890
  Amino acid metabolism
   00340 Histidine metabolism
    APA26_19890
Enzymes [BR:apx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     APA26_19890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176300..2177613
Genome map
AA seq 437 aa AA seqDB search
MKRLDTREPNFETDFTALLSNREEQGQEVHKPVADILAAVRKEGDAALCAFTERFDRLPL
TAEQLAFTAEEIEQARAKVSPELLEALDVAAQRIESFHKNQLPADIRYTDDVGMTLGLRW
IPLDAVGLYVPGGKAAYPSSVLMNAIPAKVAGVKRLAMCVPTPDGVINPLVLAAAHRAGV
TEIYRVGGAQAVGAMAYGTQTIRPVDRIVGPGNAYVAEAKRQVFGYVGIDSIAGPSDVVV
IADSNTNPRLIALDLLAQAEHDECAQATLITPDAAFADTVIEAVEAELRVLSRAAIAGAS
WARNGAVLICRDMQEAVELANRLAPEHLELMVDDPESLFAHVRHAGAAFLGRFCPEAIGD
YVGGPNHVLPTSRTARFASGLSVFDFMKRTTFLSGGPDALRQIGPAAVALAQAEGLEAHA
LSVSARLDMLAASTPNA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcttgatacgcgcgaaccgaattttgaaaccgactttaccgctcttctttcc
aaccgtgaggagcaagggcaggaagttcataaaccggttgcagatattttggctgccgtg
cgcaaagagggtgatgccgcactttgcgcctttacggaacgctttgaccgcctgcccctt
acagctgaacagcttgcttttacagcagaggaaattgagcaggcacgtgcaaaagtaagc
ccggaactgctggaagcactggatgttgcggcacagcgtatcgagtccttccataaaaac
cagctgccggctgatatccgttacacagatgatgtgggcatgacactgggcctgcgctgg
attccgctggatgctgttggcctgtatgtgcccggtggcaaagcggcctatccctcttcc
gtgttgatgaatgccattccggccaaggttgctggagtaaagcgtttggccatgtgcgtg
ccgactcctgatggcgtgattaacccgttggtattggctgctgcacatcgagctggtgtg
acagaaatctaccgtgttggtggcgcacaagctgtgggcgccatggcctatggcacacaa
accatccgcccggttgaccgtattgttggcccgggcaacgcgtacgtagccgaagccaag
cgtcaggtttttggatatgtgggcatagacagcattgctggcccatctgatgtggtggtg
attgccgattcgaatacgaatccgcgcctgattgctctggatctgctggcacaggctgag
catgatgaatgcgcgcaggctacgcttatcaccccagatgctgcgtttgcagacaccgtt
attgaagctgtagaagctgaactgcgtgtgctctcccgcgcagctattgctggcgcaagc
tgggcccgtaacggggcagtgctgatctgccgcgatatgcaggaagccgtggaactggca
aaccgtctggccccggaacatctggaactgatggtggatgacccggaaagtctgtttgcc
catgtgcgccatgccggagctgcttttctgggccgtttctgcccagaagccattggggat
tacgtaggtggccccaaccatgtgctgccaacttcgcgcacagcacgttttgcttctggc
ctgtctgtttttgacttcatgaagcgcacgacattcttatccggcgggcctgatgccctc
cgccagattgggcctgctgctgtggcactggcgcaggccgaagggctggaagcccatgcg
cttagcgtttccgccagactggatatgctggcagcctcaacacctaatgcttga

DBGET integrated database retrieval system