KEGG   Acetobacter pasteurianus IFO 3283-26: APA26_26150Help
Entry
APA26_26150       CDS       T01816                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
apx  Acetobacter pasteurianus IFO 3283-26
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APA26_26150
Enzymes [BR:apx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     APA26_26150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2833769..2834857)
Genome map
AA seq 362 aa AA seqDB search
MERGGRNVASFRLGRADEMTYARLIEPLGLVYGSIAQAAIKQGDALPLYGGPAAFTFVRL
IEGYQTAGLMSVQKVPQDWAPELERITRSVPPVGLPTGTQIMGILNITPDSFSDGGELAS
IDKAVLKAHGMVRAGATVLDIGGESTRPGAVTVTPEEEWQRVGPVLAALKAELPNVAISV
DTRNSYVMQRALAAGAHIINDVTALAYDAAALPLLASQDCGVVLMHMRGTPQTMAQHAVY
EDVSVDVVRELAQRIEVAVKGGIARHRIMVDPGFGFAKNFEQNKELLRHILLLANLGCRV
VFGVSRKRMIGNLTGETTPHLRDAGTQAASFPAMALGNPVLRVHDVTGMMQAVNVWREIY
QI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagaggcggcagaaatgtcgcctcttttcgtttgggaagagctgatgaaatgacg
tatgcgcggctgattgaacccttggggcttgtttatggcagtatagcgcaagcagctatc
aagcagggtgatgctttacctttgtatggtggtccggcggcatttacgtttgtgcgtttg
atagaaggctatcaaacagcaggtttaatgtctgtacagaaagtgccgcaggactgggct
ccggagcttgagcggataacacgttctgtaccgccagtgggtttgcctacaggtacccag
atcatgggtatcctgaatatcacgcccgatagttttagtgacggcggtgaactggcaagt
attgataaggctgttttaaaggcacacggaatggtgcgggctggcgcaaccgtgctggat
attgggggagaaagcacacgccccggtgcggtcacagtaacaccagaagaagaatggcaa
cgtgttggcccggttcttgctgccctaaaggcagaactgcctaatgtggctatttctgta
gatacgcggaacagttatgtcatgcagcgcgctttggctgctggagcacatattatcaac
gatgtaactgcccttgcgtatgatgctgcggctttgccgcttctggcctcacaagattgc
ggtgttgtgctcatgcatatgcgcggcacaccacaaactatggcgcagcatgccgtgtat
gaagatgtaagtgtagacgtggtgcgtgaactcgcacaacggattgaggttgccgtaaaa
ggtggcattgcaagacatcggattatggttgatccgggatttggttttgcaaaaaacttt
gagcagaataaggagctattgcggcatattctgctactggccaacttgggctgtcgggtt
gtatttggcgtttctcgcaagcggatgatcggcaaccttactggtgaaactacaccgcat
ttgcgggatgcaggaacgcaggcggcatcctttcctgctatggcattaggtaacccggtt
ttgcgcgtgcatgatgttacgggcatgatgcaggctgtaaacgtgtggcgggaaatatat
cagatctaa

DBGET integrated database retrieval system