KEGG   Anaplasma phagocytophilum HZ2: YYU_02670Help
Entry
YYU_02670         CDS       T02753                                 

Definition
NAD-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
apy  Anaplasma phagocytophilum HZ2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apy00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    YYU_02670
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YYU_02670
   00330 Arginine and proline metabolism
    YYU_02670
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    YYU_02670
Enzymes [BR:apy01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     YYU_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(583982..588868)
Genome map
AA seq 1628 aa AA seqDB search
MTAVRYDILSFVFYKSSVIKYTLKMHTTGDSSSSFDGHVVPSVLEALSRKSPQNIKYELL
KSFIEKFYNFSYSTDMELSAEFLLHMAEDLYQFINQRKPGESLVRVFDVARPNFPDESLT
IVETANDNLPFIVDSVMIAIKKHDLPIYHYTNSVLHIKRDDSRIVDVDILPSDSCAENGT
CESVAYFVVGKTTKDLQEKLKADVEKALYSVTCCVNDWKPMLDRVSDLLHDFEKDLSCSE
ICHFLKWMSSDNFVFLGFEEYVKSPSSSEDLVLLIERSLGLARIESHRESTKGSAYGRVH
LYVAQSNLVSNVHRHEYMMCVGIKTFNTSGDVIDVIKESCFYGFFTSAVAFQSVLDIPII
RRKVEYAEARSGFMRYGHNGKALFTIIQKFSREELLRASEEELFQISMGILSLSGNPKVK
LFTLRDTVNGFIVCIIFIPKSVASTELADRIALVLEGTLMGEVVGKYYNMYNESDLVRLQ
FTVKVAADAECLLSERDIEKLVVETTKRWEDRLAEVIMEKMGSKFLEYVTAFPKGYQEYF
APRSACHDILKIHKVLESGIGEVDLYLLDNDSQYQLKIYVPLESDLRLSKVLNVVKKMGA
KMSLHYGYDVNVHGQCMRLHHFVLSNTHRSLDHHRVKSQFETVLKQVFCKKTENDYFNSL
VILANLQWKEVLLIRALSRYLKQISFNYSQSYIQKVVRKYPDMINLFVKLFEARFDPKLS
EGREEKVASVRKSIEDLFAQVSDVVHDYVLKSMYMLIMAILRTSYYQDDKPYLSIKIDSC
AVPDMPLPRPFREIYVYSNEFEGIHLRGGRVARGGLRWSDRSEDFRTEILGLMKAQMTKN
SVIVPVGSKGGFILKGDSKKVSSVEYAVECYKNFLRGILDITDNIVDGQCVTADGIVRYD
DDDSYLVVAADKGTASFSDYANEVSAEYNFWLGDAFASGGSVGFDHKKIGITAKGAWVAA
QRHFWVMGRDIQRSTFTVIGIGDMSGDVFGNGMLMSDKICLLGAFNHKHIFVDPTPDPER
SFVERKRLFNTPGSSWQDYDAALISKGGGVFCRSSKSISLTKEMRQCFGIEDRESSISPN
CLIKHMLKAPVDMIWNGGIGTYVKSSKENNAVVGDKANDSLRIDGKEVRASMIVEGGNLG
CTQLGRVEYAEAGGQINTDFVDNSGGVICSDFEVNLKICMEMAVKDNFISLDERNKILDE
MLHDVLGIILTRHNTLETRALMLECMQAPKRVEQHHRIMQYLEKIGMLDRAIEFMPSDEE
IQKMISESKGFSTPQIAVLIAYTRMFIKGEIIKSGLLLRSGLEHVYESRYLLTYFPESMR
DRFAQYIRKHKLKHEILATCISNDIVNRMGCVFASHIESMGISIDMIVRIYVIIARVYNL
HDIWSELDRVDGAIGVDDYVRIVRKVQKFVGQATFWLFRHMHKFSDIEKRLDSLSEKTLL
LESQLTNVLCDEFLDAYRSAHEDLPKTDINPKVAQRIAGLEFSIFGMDIIDLSENSGVDL
ATVGRIYFKLRSVLSFSRIRDLATQMDSVSPYWQRIAIRNLLDDLSDYQSIIAKNIIKHM
IPKQSDMQESVDTVAQESVAAWCEQHRNQLDGYYRFLEDINSAQLDLSKLVLIIRSLSVF
TLGKDCDA
NT seq 4887 nt NT seq  +upstreamnt  +downstreamnt
ttgacagccgtaagatatgatatcctctcgtttgttttctacaagtcttctgttattaaa
tatacgttaaagatgcacactaccggagacagttcttctagttttgacgggcatgtggtt
ccctctgtactagaagctttgagtcgtaaatcgcctcaaaatataaaatatgagctgctg
aagagctttatagaaaagttttataacttttcgtacagcacagatatggaattgagtgct
gagtttcttctacacatggcagaggatttataccaatttataaaccaaagaaagccaggg
gaaagcttagtaagggtgtttgacgttgcaaggccaaacttccctgatgagtctcttaca
attgttgaaacggccaatgataatctgccgtttatagtggattcagtgatgatcgccatt
aaaaagcacgatcttcctatatatcactataccaactctgtgcttcatataaagcgagat
gatagcagaatagttgatgtggatatactaccgtctgactcttgtgcagaaaatggaact
tgtgagtctgtagcatactttgtggtaggcaagaccactaaagatttgcaagaaaagtta
aaggctgatgtggaaaaagccctttattcagtcacctgctgcgtaaatgattggaagcct
atgctcgatcgagtcagcgacttattgcatgactttgagaaagatctgagttgtagtgaa
atctgccattttttgaaatggatgtcctctgataacttcgtattcttgggatttgaggaa
tatgttaagtcaccatcttcaagtgaagatctggttttgctaatagagcgtagtctaggc
ctggctaggatagaaagccatcgggagtccacaaagggctctgcttatgggcgcgtgcac
ttatatgtagcacagtcaaaccttgtgtctaatgtgcataggcacgaatatatgatgtgc
gtgggtataaaaacatttaatacctcaggagatgtaattgatgtaattaaagaaagctgc
ttttacggtttcttcacctctgcggtggcctttcagagcgttcttgatatacctattatt
cggcgcaaagtggaatacgcagaagcgcggtctgggtttatgagatacgggcacaatggt
aaggccctttttactataatccagaagttttcaagagaagagctattgcgcgcttctgaa
gaggagctctttcaaatttcgatgggtattctttccttatcaggtaaccctaaggtcaaa
ttgttcacgctaagggatactgtaaacggatttatagtatgtattatctttattcctaag
agtgtagctagcactgaactcgctgatagaatagctctggttctagaaggaactttgatg
ggagaagtcgttggaaagtactataacatgtacaacgagtctgatcttgtgaggttacag
ttcactgttaaagttgctgctgatgctgagtgtttgctctccgaaagggatatagaaaaa
cttgtagtagagacaacaaagcgctgggaagataggcttgcagaagtcatcatggagaag
atgggctctaaattcttggagtatgtcactgcttttccaaagggttatcaggaatacttt
gctcctaggagcgcatgtcatgatatcctaaaaatccataaagttctggagagtggtatt
ggagaagtggatctatatctgcttgataatgacagtcaatatcaacttaagatatacgta
cctttggaaagtgatttacggctgtccaaggtgctcaatgtggtgaagaaaatgggcgca
aagatgtctcttcactatggctatgatgttaatgttcatggtcagtgcatgcggctgcat
cactttgtgttatcaaatactcatagatcattggatcatcacagggttaagagccaattt
gagacagtgctcaagcaagtattctgcaagaaaacagagaatgactactttaacagttta
gtaattttggcaaatctccagtggaaagaggttttgctcattagggcactcagcagatac
ttaaagcaaatatcgtttaattacagtcagtcgtacatacagaaggtggtgcgcaagtac
cctgacatgattaacctgtttgtgaagctgtttgaggctaggtttgatccaaagttatct
gaaggacgcgaagagaaagtggcgtcggttcgcaagtctatagaagatttgtttgctcag
gtttctgacgttgtacacgattatgtgctaaagagcatgtacatgctcataatggccata
ttgcgtactagttactatcaggatgataagccatatttatctatcaagatagactcctgt
gcggttcctgatatgccgttaccgcgcccgttccgtgaaatatatgtctattcgaatgag
tttgaaggcatacacttacgtggtggtagagttgctaggggtggcttgcgctggtcagac
aggtctgaagattttcgtactgaaatattaggccttatgaaggcgcagatgacgaaaaat
tctgttatcgtgcctgtaggttcaaagggtggatttattcttaagggtgattcgaaaaag
gtttcatctgtggaatatgctgtagagtgttataagaatttcttgcgcggtattctggat
attacagacaatatagtagatggccagtgcgttactgctgatggtattgtgcggtacgat
gacgatgattcataccttgttgttgctgcagacaagggtactgcttctttctctgattac
gcgaatgaggtgtccgcagagtataacttttggttaggtgatgcttttgcatcgggaggc
tctgtaggttttgatcacaagaagattggtataacagcaaaaggagcgtgggtagcggca
caaaggcacttttgggttatgggtagagatatccagaggagtacttttaccgttattggt
attggtgatatgtctggtgacgttttcggaaatgggatgctcatgtctgacaaaatttgt
ctacttggagcgtttaatcacaagcatatctttgtggatcctacaccagatcctgagagg
agttttgttgagagaaaaaggctatttaacactcctggatcatcgtggcaggattatgat
gctgctctaatttccaaaggtggaggtgttttctgtcgatcttctaaatctatttccctg
accaaggaaatgaggcaatgttttggaatagaagaccgggagagtagtatatcgccaaat
tgtctcattaagcatatgcttaaggcccctgtagatatgatatggaacggtggtatagga
acctacgttaaatcttcgaaagaaaacaatgcggttgttggtgacaaggcaaatgatagc
ctacgcattgatggaaaagaagtaagagcatccatgatagtagaaggtggaaatcttggg
tgtactcagctgggtcgtgttgagtatgcagaagctggggggcaaatcaatactgacttt
gttgacaattctggaggggtgatatgttcggattttgaagtcaatctgaagatatgcatg
gaaatggctgtcaaagataattttatatctcttgacgagaggaataaaatactagacgag
atgttgcatgacgtgcttggcattattttgacacgccataatacgcttgaaacccgagcg
ctgatgctggaatgtatgcaggcacctaagcgtgttgagcaacatcatagaatcatgcag
tatctagaaaaaattggaatgcttgacagagctatagagtttatgccaagcgacgaagag
attcagaagatgatttccgaatctaaaggcttcagtacgcctcagatagctgtgctcatt
gcttatactaggatgtttattaagggtgagattataaagtctggcttattacttcgcagt
ggcttagaacatgtgtatgagtcgcgatacttgctgacatatttcccagagagtatgagg
gatcgcttcgctcagtacatacggaagcataagttgaagcacgaaattcttgctacttgt
atatctaacgatatcgtgaacaggatgggttgtgtgtttgctagtcatatcgagagcatg
ggtatatccatagatatgatagtgaggatatacgttattattgctcgagtatataatctc
catgacatatggagcgaattggacagggtcgatggagctattggtgtagacgactatgtg
aggatagtccgcaaagttcagaagtttgtagggcaggctactttttggctcttcaggcat
atgcacaagttttctgatatagaaaagaggctagatagtctttcggagaagaccttatta
ttggagagtcagcttacaaatgtactttgcgacgagtttttagatgcgtatcgttctgcg
catgaggatttacctaagacggacatcaatccaaaggttgcgcaacggattgcggggctt
gagttctcaatttttggtatggacatcattgacctttcggagaattctggcgtagatctt
gcaactgttggacggatatattttaaactaaggtcagttctaagctttagcagaatacgc
gatttggcgacacaaatggattctgtatctccgtactggcagcgtattgctattagaaac
ttgttggatgatttgagtgattatcagtcgataattgctaagaacataatcaagcacatg
ataccgaaacagtctgacatgcaggaatctgtagatacggttgcgcaggagtctgtcgct
gcatggtgtgagcaacataggaatcagcttgacgggtactataggtttcttgaagacata
aactcagctcagcttgatcttagcaaacttgtactgattatcaggtctctgagtgtattt
actttaggtaaagactgcgatgcttaa

DBGET integrated database retrieval system