KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_04110Help
Entry
APA32_04110       CDS       T01817                                 

Definition
polysaccharide/O-antigene exporter permease protein
Orthology
K09690  
lipopolysaccharide transport system permease protein
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:apz02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(427474..428505)
Genome map
AA seq 343 aa AA seqDB search
MARCFGAEQAYAAGHNGSIKSMPTLHKQAGFSIALNTMNSTPTLPDTQEERAAKKQPPLS
AAPQHAPQPEGQPVLHLVPERGFSYFMHAAQDFARGFRHARLGLTLAWLDIRLRYRGSIL
GPFWLTATTAIMVAAMGVLYAYLLNTDVHTYLPFLTLSLVLWGFVGGTMQEGCGTFTGAA
RLIHAARMPYSLHVLRVAVRNILVFAHNVPVVAGVFLWFHVAPKWTWTLLPATGLWLVDC
FFAVLLLGILGARFRDVPPIIASLTQVMFFVTPILWSPQLMTTGQAWLLLDPFFPLIEIL
RAPFTGDVMQTAVWPAALGWSAVLIIVTFCLFARMRTRLAYWV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctgctttggggcggaacaggcctatgcggcaggtcataatggcagcataaaa
agcatgccaaccttgcacaaacaggcagggttctctatcgcgttaaacaccatgaacagc
acgcccaccttgccggatacgcaggaagaacgcgccgcaaaaaaacagccccctctttcg
gctgcgccgcagcacgccccgcagccagagggacagcctgtgctgcatttggtgccagaa
cgtggtttttcctactttatgcatgccgcccaggattttgcgcgcggcttccgccatgcg
cggctggggcttacgctggcctggctggatattcggctgcggtatcgtggctccattttg
gggccgttctggcttacggccaccacggccattatggtggcggccatgggcgtgctgtat
gcgtatctgctcaacacggatgtgcacacctatctgcccttccttaccctttctttggtg
ttatggggctttgtaggcggcaccatgcaggaaggctgcggcacctttacgggggctgcg
cggcttattcatgcagcccgcatgccgtattccctgcacgtgctgcgcgtggctgtacgc
aacattttagtgtttgcgcataacgtgcccgtagtggccggggtgtttttgtggtttcac
gttgcgcccaaatggacatggactctgctgcccgccacgggcctgtggctggtagactgc
ttttttgccgtgcttttgctgggcattctgggcgcacgctttagggatgtgccccccatt
atcgccagcctgacgcaggtgatgttctttgtcacacccattctgtggtctccccagttg
atgacaaccgggcaggcctggctgctgttggaccccttctttccgctgattgaaattttg
cgcgccccctttaccggagacgtgatgcaaactgccgtatggcctgcggctcttgggtgg
tctgccgtgctgataattgtaaccttctgcctgttcgcccgtatgcgcacacggctggca
tactgggtgtaa

DBGET integrated database retrieval system