KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_06880Help
Entry
APA32_06880       CDS       T01817                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    APA32_06880
Enzymes [BR:apz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     APA32_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
708905..709558
Genome map
AA seq 217 aa AA seqDB search
MAHNAQGNHNGAERRRGVCLVISAPSGAGKSTIANALRASEPVLKHSVSVTTRQPRPGEK
EGVHYHFRTMEDFERMAANGELLEWATVFGRGYGTPRAPVEAALAAGHDMVFDIDWQGHQ
QIRRALPDDVVSLFVLPPSLEELERRLRGRASDHPDEIARRMAAARDEISHWREFDHVII
NTDLDRAITEARAVLTAARLQTRRRTGLLDFVASFGA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaacgcacagggtaaccataacggagcagaacggcggcgcggtgtgtgcctg
gttatttctgcgccatccggggcgggtaagtccaccattgccaatgcactgcgtgcttcc
gagcctgtgctcaagcactcggtttccgtgaccacgcgccagccaaggccgggggaaaag
gaaggcgtgcattatcacttccgtaccatggaagattttgagcgcatggccgcaaatggt
gagttgctggaatgggccaccgtgtttgggcgtggttacggcacaccccgcgccccggtg
gaggctgccttggctgccgggcacgatatggtgtttgacatagactggcagggccaccag
caaattcgccgtgcactgcccgatgatgtggtgagcctgtttgtgctgccgccatcattg
gaggaactggaacgccgcctgcgtggccgtgcatcagaccaccccgatgaaattgcccgg
cgcatggccgccgcacgggatgaaatctcgcattggcgggaatttgaccacgtgattatc
aatacggatctggaccgcgccattacggaagcccgcgcggtgctaacggcggcacgcctg
caaacccgtcggcgcacggggctgttggattttgttgccagttttggagcctga

DBGET integrated database retrieval system