KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_07350Help
Entry
APA32_07350       CDS       T01817                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:apz00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
757992..758537
Genome map
AA seq 181 aa AA seqDB search
MSSLTVYKDTTPEHPVLQTQDPAEMARVLAPLGVRFERWEGPQIPPRDADEQAVLDVYGP
FLDKLMGETGAGSADVLRVSPSTPNREALRDKFLSEHTHSEDEIRFFVHGSGHFILHIAG
YVYDVECTQTDLISVPEGTKHWFDAGPEPDMVTLRIFTHKEGWVARYTGTDIARQFPSYA
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagttccctgacagtttacaaagataccacccccgaacaccccgtgctgcaaacgcag
gacccggcagaaatggcccgcgttctggcaccactaggcgtacggtttgaacgttgggaa
ggcccgcaaattcccccaagggatgcagatgagcaggccgtgctggatgtgtatggccca
tttttagacaagctgatgggcgaaacaggtgcaggctctgccgatgtgctgcgggttagc
ccatctacacccaaccgtgaggccttgcgggacaagttcctgtccgaacatacgcatagt
gaagatgaaattcgcttttttgtgcacggtagcgggcacttcatcctgcatattgcaggc
tatgtttacgatgtggaatgcacgcaaaccgatctgatttccgtgccagagggcacaaag
cactggtttgatgccgggccagagccagatatggttacgctgcgcattttcacacacaag
gaaggctgggtggcccgctatacaggcaccgatattgcccggcagtttccttcttacgca
aactga

DBGET integrated database retrieval system