KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_07670Help
Entry
APA32_07670       CDS       T01817                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APA32_07670
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA32_07670
  Amino acid metabolism
   00310 Lysine degradation
    APA32_07670
Enzymes [BR:apz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APA32_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
798345..799586
Genome map
AA seq 413 aa AA seqDB search
MSVEIKVPTLGESVTTATVAKWLKQPGDAVQADEPIVELETDKVSVEVSAPQAGILGPQA
AKEDQEVEVGALLTTLEPAKAGAAPAAKAAAPEKKAEPVAAAAPAKAAAPAPKAAAPAPA
VDAGAALPAARKMMAENGLSAQQLAGTGLGGRITKGDVLGFLANPQAATPAAAPKPPRND
DPREERVKMTRLRRTIARRLKEAQNTAAMLTTFNEIDMSGAMALRAEYQDSFVKKHGVKL
GYMSIFSRAVVAALKEFPAINAEIDGDDVIYRDFVNLGIAVGGPNGLVVPVIRDADKMSY
AEIEKTIAGFGKAAREGTLKLDQLSGGTFSITNGGIYGSLLSTPILNAPQSGILGMHSIQ
ERPVAVNGQVVIRPMMYIALSYDHRIVDGKEAVSFLVRVKQNVEDPRRLLIEV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgagatcaaggtgccgacactgggtgaaagcgtaaccacagcaaccgtggcc
aagtggctgaagcagccgggcgacgcggtgcaggcagatgaaccgattgttgagctggaa
accgataaggtgagcgtggaagtttctgcgccgcaggctggtattctgggcccacaggct
gccaaggaagaccaggaagtagaagtgggcgcattgctgaccacgctggaacccgccaag
gctggcgctgcaccagccgccaaagccgctgccccggaaaagaaagcagaacccgtagcg
gctgccgctccggcaaaagcagccgcaccagcacctaaggccgcagccccggctccggca
gtagatgccggtgctgctctgcccgcagcccgcaagatgatggctgaaaacggcctgagc
gcacagcagcttgcaggcaccggccttggtggccgcattaccaaaggggatgtgctgggc
tttttggccaacccgcaggctgcaacaccagccgcagcccccaagccgccgcgtaatgat
gacccgcgcgaagaacgcgtgaagatgacgcgcctgcgccgcaccattgcccgccgcctg
aaggaagcacagaacacggcggccatgctgacaacgtttaatgaaatcgacatgtccggc
gccatggcgctgcgtgccgagtatcaggactcgtttgttaaaaagcacggtgtcaagctg
ggctatatgtccatcttctcccgcgctgttgtggctgccctgaaagagttcccggccatt
aacgcagaaattgacggtgatgatgtgatctaccgtgatttcgtaaacctcggcattgcc
gtgggtgggccaaacgggctggtggtgccggttatccgtgatgccgacaagatgagctat
gccgaaattgaaaaaaccattgcaggttttggcaaggcagcgcgtgaaggcacgttgaag
ctggatcagctttctggcggcaccttctccatcaccaatggcggtatttacggttctctg
ctgtccacccccatcctgaatgcacctcagtccggtattctgggcatgcactccattcag
gaacgcccggtggcagtgaacgggcaggtggtgatccgcccgatgatgtatattgccctt
tcttatgatcaccgcattgtagatggcaaggaagccgtcagcttccttgtgcgggtgaag
cagaacgtagaagacccgcgccgccttctgattgaagtctga

DBGET integrated database retrieval system