KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_12200Help
Entry
APA32_12200       CDS       T01817                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apz01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:apz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1275929..1276795)
Genome map
AA seq 288 aa AA seqDB search
MNDTPLASSAASASDTLASKIDELPDVLSRICARTKLEVEHRSTLMSLKEITAKAQETKE
APRGFGRALKEKAADRAVGLIAEIKKASPSAGILRETYDPAEIAAEYEQAGAACISVLTE
SSCFHGDNEDLGKARAACSLPVLRKDFILDPWQVYESRMIGADCILLIMSILSDEMALEL
VDHAKGLDMDVLVEVHDEEELNRALALDTFLIGINNRNLKTLQTSLDTTRELSPLVPPDR
IIVSESGIKTHEDIVQLSSIGVTGFLVGESLLRDQHPGDAAKKLLGLA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatacaccactcgcgtcctcggcagcttctgcttcggacactcttgccagcaag
attgacgaactgccggatgttctctcccgcatctgcgcacgcaccaagctggaagttgaa
catcgctccaccctgatgtcccttaaggaaatcacggcaaaagcgcaggaaaccaaagag
gcaccgcgcgggtttggccgggcgctgaaggaaaaagctgcggaccgggccgttggcctg
attgcagaaatcaagaaggcttctccttcagccggtatcctgcgtgaaacctatgatccc
gcagaaattgccgcagaatatgagcaagccggtgcagcctgtatttccgtgctgaccgaa
agctcctgctttcatggggataacgaagatctgggcaaggcgcgggctgcatgctccctt
cctgttctgcgcaaggattttatccttgatccgtggcaggtttatgaaagccgcatgatc
ggggcagattgcattctgctgattatgtccattctgtccgatgaaatggcgctggaactg
gttgaccatgccaaagggctagatatggatgtgctggtagaagtgcatgatgaggaagaa
ctcaaccgcgcccttgcgctggataccttcctgatcggtatcaacaaccgcaacctcaaa
acacttcaaaccagcttagacaccacgcgggagctttctccgcttgtgccgccagatcgg
attatcgtgtctgaaagcggcatcaaaacgcatgaagatatcgtgcagctttccagcatc
ggtgtaacgggctttctggtgggtgaatccctcctgcgagatcagcacccgggcgatgcc
gccaaaaaactgctggggctggcctaa

DBGET integrated database retrieval system