KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_16240Help
Entry
APA32_16240       CDS       T01817                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:apz00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:apz00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1758086..1758574
Genome map
AA seq 162 aa AA seqDB search
MNLTCIYDFKLPALNGSTLDLSAYRGKPVLVVNTASKCGFTPQYEGLQALWTQFQKAGLV
VVGVPSNDFGQQEPGTSEEISSFCQINYGVTFPMAARSPVKGPDAIPLFKWLDSELGFLA
RPRWNFFKYLTNRQGMPVAWFSSLTPPTSGRVRHAVEKALKS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgacctgtatatatgattttaaactccccgccctaaatggaagcacccttgat
ctgagcgcttatcgggggaaacctgttctggtggtgaacaccgcatctaaatgcggattt
accccgcaatatgaaggcttgcaggctttgtggacacagttccaaaaagccgggctggtt
gttgtgggggtgccaagcaatgattttggccagcaggaacccggcacttcggaagagatt
tcctccttctgccagatcaattacggggttaccttccctatggcggcacgcagccctgta
aaagggccagatgctattcctctctttaaatggctggatagtgagcttgggtttctggct
cggccacggtggaacttctttaagtatctcaccaaccgtcagggtatgccagttgcatgg
tttagcagcctaacaccgcctacatccgggcgtgtcaggcatgctgtggaaaaggctctc
aaatcgtaa

DBGET integrated database retrieval system