KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_16770Help
Entry
APA32_16770       CDS       T01817                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00260  Glycine, serine and threonine metabolism
apz00750  Vitamin B6 metabolism
apz01100  Metabolic pathways
apz01110  Biosynthesis of secondary metabolites
apz01120  Microbial metabolism in diverse environments
apz01230  Biosynthesis of amino acids
Module
apz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA32_16770
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APA32_16770
Enzymes [BR:apz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APA32_16770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAI15048
NITE: APA32_16770
Position
1819955..1821355
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGNAPVLSFADVLLTGLAEDGGLYLPETWPEFSLPDWESLRGLPYPELAARVLA
PFAAPDIDLETLRGLCAKAYANFDHPAIVPLTQVEDGLFVQELFHGPTLAFKDMAMQVLG
QLFEHVLTQRNDHVTIVGATSGDTGSAAIEACRGRDRLSVIILHPKGRTSEVQRRQMTTV
LDSNVTNLAVEGTFDDCQDLVKALFADLPFRREMHLSAVNSINWARIAAQIPYYVYAALN
FGAPEREVSFAVPTGNFGNILAAWAARKMGLPIKHLCVGSNRNDILTRFLNANDMTIKGV
VPSLSPSMDIQVSSNFERLLFELLGRDSAACARIMTGFRATGHMDVPEEVWENARTVFSG
LALDDEQTEAEIRNLHQKSNYLADPHSAIGIAAGRKFRQPGVPMIAEATAHPAKFPDAMV
AATGIHPALPVHLEDLFEREERYRTVPATAGAIKDAVRAAVLANAP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatttccacacgcgggaatgctcccgtcctttcctttgccgatgttctgctt
accggtcttgccgaggatggcggcctgtatctgcccgaaacatggcccgaattctcgctg
cctgattgggaaagcctgcgtggcctgccctatccggaactggctgcccgtgttctggcc
ccgtttgcagcaccggatattgatctggaaacactgcgcggcctgtgcgccaaggcctat
gccaactttgaccacccagccattgtgccgctaacgcaggtggaagatggcctgtttgtg
caggaactgttccacggccccacgctggcgttcaaagacatggccatgcaggtgctcggc
cagctttttgaacacgtactcacccagcggaatgatcacgtaaccattgtaggtgccacc
tctggcgatacaggttccgccgccattgaagcctgccgtgggcgggaccgtctgtctgtt
atcatcctgcaccccaaaggccggacatcggaagtgcagcgccgccagatgacaaccgtg
ctggattccaacgtgaccaatctggccgttgaaggcacgtttgatgactgtcaggacctg
gtaaaggctctgtttgctgatctgcctttccgccgggaaatgcatctttccgccgtcaat
tccatcaactgggcgcgtattgcggctcagatcccttactatgtttatgcggccttgaac
tttggtgccccagagcgtgaagtttcctttgctgtgcctacaggcaactttggcaacatt
cttgctgcttgggctgcacgcaaaatggggctgcctatcaaacatctgtgcgttggttcc
aaccggaacgatattctcacccggttcctgaatgccaatgacatgaccatcaaaggtgtg
gtgcctagcctttcaccttccatggacattcaggtttcttccaactttgaacgtttgctg
tttgagcttctgggtcgtgattctgctgcctgcgcacgtatcatgaccggcttccgcgcc
acggggcatatggatgtgcctgaagaagtgtgggaaaatgctcgcaccgtcttctctggc
cttgcgctggatgatgagcagacggaagcggaaattcgtaacctgcaccagaaatccaat
tatctggcagacccccacagcgccattggcattgctgcgggccgcaagttccgacagccg
ggcgtgcccatgattgcagaagccaccgcgcatccggccaagttccccgatgccatggtg
gcagctacgggtattcatccggcactgcctgtgcatctggaagatctgtttgagcgggaa
gaacgttatcgcactgttccggcaaccgcaggcgcaattaaagatgctgtgcgcgctgcg
gtactggcaaacgctccctaa

DBGET integrated database retrieval system