KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_18940Help
Entry
APA32_18940       CDS       T01817                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apz00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:apz00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2058783..2060252
Genome map
AA seq 489 aa AA seqDB search
MSLPLSTLLAAVGLPILPENPEISAITADSRQIKPGTIFAALPGVKTDGRAFIAMAVQNG
AAAVLAPTDTQWPTGVPTCPLILAPNPRHALALMAAVLAGPQPQHLAAITGTNGKTSTAD
FIRQIWALQGFKAAAIGTLGLTGAEDTSISFPALTTPDPVALANGLAALTQAGFNHVALE
ASSHGLEQGRLDGLHLAAAGFTNLTRDHLDYHLTIEAYRTAKLKLFDTLLPQQAIAAANA
DMDAQTLQAIRALAARRNLRLRLVGEQGTTLRLMAHNALPAGQELSIEHNGHTSTVLLPI
PGRFQADNVLLAVALAAQDDAEIADILPLLPHLKGVRGRLERATVLPNGACAYVDYAHTP
DALARLLASLRPHARGKLVVVLGAGGDRDSGKRPLMGQEAIKGADIAIITDDNPRTENPA
SIRAEIKAGAPQALEIADRKQAIAEALSMLKADDVLVVAGKGHEQGQIIGNTILPFDDAA
VLRTLAGHP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcccctctccacccttcttgcggctgtagggctgcctatcctgcctgaaaat
cctgaaatttctgccattacagcggatagtcggcagataaagccgggcacaatttttgca
gctttgccgggcgttaaaaccgatggccgagcctttattgcaatggccgtgcaaaatggt
gcggctgcagtgttggctccaacagatacacagtggccaacaggtgtgcccacctgcccg
cttattctggcacccaacccgcgccacgcgctggcgcttatggcggctgttctggcaggg
cctcaaccacagcatctggcggccattaccggcacaaatggcaaaaccagtactgcggat
tttattcgccagatatgggcattacaggggtttaaagctgctgccattggcacacttggc
ctgaccggggcggaagatacgtccatttccttccccgcgcttacaacgccagatccggtt
gctcttgccaatgggctggctgcacttacccaagccgggtttaaccatgttgcactagaa
gcctcatcacacgggttggaacaagggcggctggacggtttgcaccttgcagccgcgggt
tttaccaatctgacgcgagatcatctggattatcatctgacgatcgaagcgtatcgcaca
gccaaactaaagctgtttgatactcttctgccacaacaggccattgccgcagccaatgcc
gatatggatgcgcaaacgcttcaggccatccgtgcccttgccgcccgccgaaacctgcgg
ctaaggctggttggagaacagggtacaacattacgccttatggcacacaatgctcttcct
gctggacaggaactgagcattgagcacaatggccacaccagcacggttctcctccctatt
ccgggacgctttcaggcagataacgtattgctggctgtagctcttgccgcgcaggatgat
gccgagattgcagatattctgccccttctgccgcacctcaaaggggttcgggggcggctg
gaacgtgcaaccgttctgcccaacggggcctgtgcgtatgtagattacgctcacacgcca
gatgcgctggcacggcttttggcatctttgcgcccccacgcacgcggcaagttggttgtt
gttctgggtgctgggggtgatcgtgatagtggcaaacgccctcttatgggtcaggaagcc
attaaaggtgcagatattgccattattacagatgacaacccgcgcacagaaaacccagcc
tccattcgtgcagagataaaagccggtgccccgcaggcgctggaaattgcagatagaaaa
caagcaatagcagaagctctttccatgcttaaagcagacgatgtactggttgtagccggc
aaaggccacgaacagggacagattataggcaataccattttaccgtttgatgatgccgcc
gtgttgcgcacactggcgggccatccatga

DBGET integrated database retrieval system