KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_19890Help
Entry
APA32_19890       CDS       T01817                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apz01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apz00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2173633..2174946
Genome map
AA seq 437 aa AA seqDB search
MKRLDTREPNFETDFTALLSNREEQGQEVHKPVADILAAVRKEGDAALCAFTERFDRLPL
TAEQLAFTAEEIEQARAKVSPELLEALDVAAQRIESFHKNQLPADIRYTDDVGMTLGLRW
IPLDAVGLYVPGGKAAYPSSVLMNAIPAKVAGVKRLAMCVPTPDGVINPLVLAAAHRAGV
TEIYRVGGAQAVGAMAYGTQTIRPVDRIVGPGNAYVAEAKRQVFGYVGIDSIAGPSDVVV
IADSNTNPRLIALDLLAQAEHDECAQATLITPDAAFADTVIEAVEAELRVLSRAAIAGAS
WARNGAVLICRDMQEAVELANRLAPEHLELMVDDPESLFAHVRHAGAAFLGRFCPEAIGD
YVGGPNHVLPTSRTARFASGLSVFDFMKRTTFLSGGPDALRQIGPAAVALAQAEGLEAHA
LSVSARLDMLAASTPNA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcttgatacgcgcgaaccgaattttgaaaccgactttaccgctcttctttcc
aaccgtgaggagcaagggcaggaagttcataaaccggttgcagatattttggctgccgtg
cgcaaagagggtgatgccgcactttgcgcctttacggaacgctttgaccgcctgcccctt
acagctgaacagcttgcttttacagcagaggaaattgagcaggcacgtgcaaaagtaagc
ccggaactgctggaagcactggatgttgcggcacagcgtatcgagtccttccataaaaac
cagctgccggctgatatccgttacacagatgatgtgggcatgacactgggcctgcgctgg
attccgctggatgctgttggcctgtatgtgcccggtggcaaagcggcctatccctcttcc
gtgttgatgaatgccattccggccaaggttgctggagtaaagcgtttggccatgtgcgtg
ccgactcctgatggcgtgattaacccgttggtattggctgctgcacatcgagctggtgtg
acagaaatctaccgtgttggtggcgcacaagctgtgggcgccatggcctatggcacacaa
accatccgcccggttgaccgtattgttggcccgggcaacgcgtacgtagccgaagccaag
cgtcaggtttttggatatgtgggcatagacagcattgctggcccatctgatgtggtggtg
attgccgattcgaatacgaatccgcgcctgattgctctggatctgctggcacaggctgag
catgatgaatgcgcgcaggctacgcttatcaccccagatgctgcgtttgcagacaccgtt
attgaagctgtagaagctgaactgcgtgtgctctcccgcgcagctattgctggcgcaagc
tgggcccgtaacggggcagtgctgatctgccgcgatatgcaggaagccgtggaactggca
aaccgtctggccccggaacatctggaactgatggtggatgacccggaaagtctgtttgcc
catgtgcgccatgccggagctgcttttctgggccgtttctgcccagaagccattggggat
tacgtaggtggccccaaccatgtgctgccaacttcgcgcacagcacgttttgcttctggc
ctgtctgtttttgacttcatgaagcgcacgacattcttatccggcgggcctgatgccctc
cgccagattgggcctgctgctgtggcactggcgcaggccgaagggctggaagcccatgcg
cttagcgtttccgccagactggatatgctggcagcctcaacacctaatgcttga

DBGET integrated database retrieval system