KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_22590Help
Entry
APA32_22590       CDS       T01817                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00071  Fatty acid degradation
apz00280  Valine, leucine and isoleucine degradation
apz00310  Lysine degradation
apz00360  Phenylalanine metabolism
apz00380  Tryptophan metabolism
apz00410  beta-Alanine metabolism
apz00627  Aminobenzoate degradation
apz00640  Propanoate metabolism
apz00650  Butanoate metabolism
apz00903  Limonene and pinene degradation
apz00930  Caprolactam degradation
apz01100  Metabolic pathways
apz01110  Biosynthesis of secondary metabolites
apz01120  Microbial metabolism in diverse environments
apz01130  Biosynthesis of antibiotics
apz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APA32_22590
   00650 Butanoate metabolism
    APA32_22590
  Lipid metabolism
   00071 Fatty acid degradation
    APA32_22590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APA32_22590
   00310 Lysine degradation
    APA32_22590
   00360 Phenylalanine metabolism
    APA32_22590
   00380 Tryptophan metabolism
    APA32_22590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APA32_22590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APA32_22590
   00281 Geraniol degradation
    APA32_22590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APA32_22590
   00627 Aminobenzoate degradation
    APA32_22590
   00930 Caprolactam degradation
    APA32_22590
Enzymes [BR:apz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APA32_22590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAI15614
NITE: APA32_22590
Position
complement(2455709..2456728)
Genome map
AA seq 339 aa AA seqDB search
MTEQTLSAVSGVRMQQEGHLGRIILDRPKRLNAVDISMASGIKAALQTWRDDPSIHTILL
ESSSTRAFCAGGDLRAIHDCLKAQGALAAYELMKRVYDVMLLLADYKKPIVSFLDGVAMG
GGIGLGGHVRYRVVTETSVLAMPETAIGLAPDAGGSWLLARAPGFSGLRRAVTGGRMNGA
EAVAMGFADVLVSSASLADLRETLSIESAEHVFARLHSQPESLDVQNLDSCYNAPDILQV
IEKLKAEGSEDAQEDLEALSRACPFSVQVAWSGWHRARAASSLHEAFTLEENMVHHMVAR
PDFAEGIRARLIDKDNSPAWVPPALAEVNEQEVQNCFDK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcaaactctttccgccgtatctggcgtaagaatgcagcaagaagggcattta
gggcgtattattttagaccgtcccaaacggttgaatgctgtggatatcagtatggccagt
ggcataaaggccgctttacagacatggcgggatgatccgtctattcacactattcttctg
gaaagcagcagcacgcgtgccttttgcgccgggggagacctacgcgccattcatgattgc
ctaaaagctcaaggggcattggcagcatatgaacttatgaagcgcgtatatgatgtcatg
ctgctgttggcagattacaaaaaacccattgtttcctttttagatggcgtagctatgggc
ggcggtattggcttgggtggtcatgtacgatatcgagtagttacggaaacatctgtgctg
gctatgcctgaaactgctattggtctggccccggatgctgggggaagctggctgttagcc
cgcgctcctggtttttctggcttacggcgtgccgttactggtgggcgtatgaacggggca
gaggctgtggccatggggtttgctgatgttttggtttcatcggcttctcttgcagattta
agagagacgttgagtattgaaagtgcagaacatgtatttgcacgcctccattcccagccc
gaaagcctagacgtgcaaaatctggattcctgttacaatgcgccagatatcttgcaggtt
attgaaaagctgaaagcggaaggatcagaagatgcgcaagaggaccttgaagcgttatca
cgtgcctgtccgttttctgtgcaggtagcatggtctggatggcaccgggcgcgtgcagct
tcctcattacatgaggcttttacacttgaggaaaacatggtgcaccatatggtagcccgg
cccgattttgcagaaggtattcgagcccgcttgattgataaagataatagtcctgcgtgg
gtgcctcctgctttggcggaagtgaatgagcaggaagttcaaaattgttttgataagtaa

DBGET integrated database retrieval system