KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_26150Help
Entry
APA32_26150       CDS       T01817                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2831102..2832190)
Genome map
AA seq 362 aa AA seqDB search
MERGGRNVASFRLGRADEMTYARLIEPLGLVYGSIAQAAIKQGDALPLYGGPAAFTFVRL
IEGYQTAGLMSVQKVPQDWAPELERITRSVPPVGLPTGTQIMGILNITPDSFSDGGELAS
IDKAVLKAHGMVRAGATVLDIGGESTRPGAVTVTPEEEWQRVGPVLAALKAELPNVAISV
DTRNSYVMQRALAAGAHIINDVTALAYDAAALPLLASQDCGVVLMHMRGTPQTMAQHAVY
EDVSVDVVRELAQRIEVAVKGGIARHRIMVDPGFGFAKNFEQNKELLRHILLLANLGCRV
VFGVSRKRMIGNLTGETTPHLRDAGTQAASFPAMALGNPVLRVHDVTGMMQAVNVWREIY
QI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagaggcggcagaaatgtcgcctcttttcgtttgggaagagctgatgaaatgacg
tatgcgcggctgattgaacccttggggcttgtttatggcagtatagcgcaagcagctatc
aagcagggtgatgctttacctttgtatggtggtccggcggcatttacgtttgtgcgtttg
atagaaggctatcaaacagcaggtttaatgtctgtacagaaagtgccgcaggactgggct
ccggagcttgagcggataacacgttctgtaccgccagtgggtttgcctacaggtacccag
atcatgggtatcctgaatatcacgcccgatagttttagtgacggcggtgaactggcaagt
attgataaggctgttttaaaggcacacggaatggtgcgggctggcgcaaccgtgctggat
attgggggagaaagcacacgccccggtgcggtcacagtaacaccagaagaagaatggcaa
cgtgttggcccggttcttgctgccctaaaggcagaactgcctaatgtggctatttctgta
gatacgcggaacagttatgtcatgcagcgcgctttggctgctggagcacatattatcaac
gatgtaactgcccttgcgtatgatgctgcggctttgccgcttctggcctcacaagattgc
ggtgttgtgctcatgcatatgcgcggcacaccacaaactatggcgcagcatgccgtgtat
gaagatgtaagtgtagacgtggtgcgtgaactcgcacaacggattgaggttgccgtaaaa
ggtggcattgcaagacatcggattatggttgatccgggatttggttttgcaaaaaacttt
gagcagaataaggagctattgcggcatattctgctactggccaacttgggctgtcgggtt
gtatttggcgtttctcgcaagcggatgatcggcaaccttactggtgaaactacaccgcat
ttgcgggatgcaggaacgcaggcggcatcctttcctgctatggcattaggtaacccggtt
ttgcgcgtgcatgatgttacgggcatgatgcaggctgtaaacgtgtggcgggaaatatat
cagatctaa

DBGET integrated database retrieval system