KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_26530Help
Entry
APA32_26530       CDS       T01817                                 

Definition
amido transferase HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apz01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apz00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2872323..2873024
Genome map
AA seq 233 aa AA seqDB search
MATGFRQGHQQQEGSMTQPLSIAVVDYEGGNLASAARAALRAAELSGIAADVVITNEPTA
VLQADRIILPGQGAFADCARGLEAIPGLKDSILNATAKGTPFLGICVGMQLMAERGREHG
VTEGFGWIPGEITLMEATGLRLPQMGWNELELHTQHPLTQGLGAAPHGYFVHSYALQNTA
TDVLLATTDYGGSVPAIVCKGNVAGTQFHVEKSQTVGLKILANFLRWDPKAPV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggattcagacagggtcaccagcaacaagagggttccatgacccagcctctt
tccatcgccgttgttgattatgaaggcggcaatctggcgtccgctgcccgtgctgccctg
cgggctgctgagctttcgggcattgcagccgatgttgttattaccaacgagcccacggct
gttttgcaggcagaccgtattatcctgcccgggcaaggcgcatttgcagattgcgcccgt
gggttggaggccattcccggcctaaaagattccatcctgaacgctacagccaaaggcaca
ccctttttgggcatttgcgtaggtatgcagcttatggctgaacgcgggcgagaacatgga
gtaacagaaggctttgggtggattccgggggaaatcaccctcatggaagccacaggtctt
cgccttcctcaaatgggctggaacgagttggaactgcatacgcagcaccccctcacccaa
ggcttgggcgctgctccgcacggttactttgtgcattcctacgccctgcagaataccgct
accgatgttctacttgccactacggattacggtggcagcgtgcctgccatagtgtgtaag
ggaaatgttgctggcacacagtttcatgttgaaaaaagccagacagttggcctcaagatt
ctcgccaattttctacggtgggatccgaaagcgcccgtataa

DBGET integrated database retrieval system