KEGG   Aquaspirillum sp. LM1: BXU06_08695Help
Entry
BXU06_08695       CDS       T04696                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00071  Fatty acid degradation
aql00072  Synthesis and degradation of ketone bodies
aql00280  Valine, leucine and isoleucine degradation
aql00310  Lysine degradation
aql00362  Benzoate degradation
aql00380  Tryptophan metabolism
aql00620  Pyruvate metabolism
aql00630  Glyoxylate and dicarboxylate metabolism
aql00640  Propanoate metabolism
aql00650  Butanoate metabolism
aql00900  Terpenoid backbone biosynthesis
aql01100  Metabolic pathways
aql01110  Biosynthesis of secondary metabolites
aql01120  Microbial metabolism in diverse environments
aql01130  Biosynthesis of antibiotics
aql01200  Carbon metabolism
aql01212  Fatty acid metabolism
aql02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aql00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BXU06_08695
   00630 Glyoxylate and dicarboxylate metabolism
    BXU06_08695
   00640 Propanoate metabolism
    BXU06_08695
   00650 Butanoate metabolism
    BXU06_08695
  Lipid metabolism
   00071 Fatty acid degradation
    BXU06_08695
   00072 Synthesis and degradation of ketone bodies
    BXU06_08695
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BXU06_08695
   00310 Lysine degradation
    BXU06_08695
   00380 Tryptophan metabolism
    BXU06_08695
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BXU06_08695
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BXU06_08695
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BXU06_08695
Enzymes [BR:aql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BXU06_08695
Exosome [BR:aql04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BXU06_08695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQR65129
UniProt: A0A1U9JM35
Position
2028208..2029386
Genome map
AA seq 392 aa AA seqDB search
MTKDVLVLSAVRSAVGTFNGSLASLEPADLAGRVMKEAIARSGVDAQAINYVTVGNCIPT
ESRFAYVARVASIQAGLPMESVAMAVNRLCSSGLQAVVSTAQNILLGDCDYGIGGGVEVM
SRGAYMLPALRSGARLGNTQAIDMMVDTLTDPFGVGHMGITAENLASKWGISREDQDAFA
LESQQRAAKAIAEGRFAGQIVPITLKGRKGDTVFDTDEHPRATTLEALAAMKPAFKKDGS
VTAGNASGLNDGAAFLVLADAATAMNAGHKAMARLVSYAVAGVPNDVMGEGPIPATKLAL
KKAGLSLDQIDVIESNEAFASQALAVAKALELDLGKTNVNGGAIALGHPVGCSGALIATK
ALHELHRVQGRYALVTMCIGGGQGIAVIFERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagacgttttggtattgagcgccgtgcgctcggcggtgggtacgttcaatggc
tcgctggccagcctggaaccggctgatctggctggccgggtgatgaaagaagcgattgcc
cgctccggcgtggacgctcaggccatcaattacgtgaccgtgggcaactgcatccccacc
gagtcgcgctttgcctacgtggctcgtgtggcatcgattcaggccggtctgccgatggaa
tcggtggcaatggcggtaaaccgcctgtgctcgtccggcctgcaggctgtggtcagcact
gcgcaaaacattttgctgggtgattgcgactacggcattggcggcggcgtggaagtgatg
tcgcgcggtgcttacatgctgccggcgctgcgcagcggtgcccgtctgggcaatacccag
gccatcgacatgatggtggacaccctgaccgacccgtttggcgtcggccacatgggcatc
accgctgaaaacctggccagcaagtggggcatcagccgcgaagatcaggacgcctttgcg
ctggaatcgcagcaacgcgcggccaaagccatcgccgaaggccgttttgccggccagatc
gtgccgatcacgctgaagggccgcaagggcgacaccgtgttcgataccgacgaacacccg
cgcgccaccacgctggaagcgctggcagccatgaagccggccttcaagaaagatggctcg
gtgacggcaggtaacgcctccggcctgaacgacggcgcagctttcctggtgctggctgat
gccgccacggcgatgaacgctggccacaaggcgatggcgcgtctggtgtcttatgccgtg
gccggggtgcccaacgatgtgatgggcgaaggcccgattccggctaccaagctggcgctg
aaaaaagccggcctgagcctggaccagatcgatgtgatcgaatccaacgaagcatttgcc
tcgcaggcgctggccgtggccaaggcgctggaactggatctgggcaagaccaacgtcaac
ggcggtgccattgccctgggtcacccggtgggctgctccggtgcgctgattgccaccaag
gcgctgcacgaactgcatcgcgtgcaaggccgttacgcgctggtgaccatgtgtatcggc
ggcggtcagggcattgcggtgatttttgaacgggtgtaa

DBGET integrated database retrieval system