KEGG   Amphimedon queenslandica (sponge): 100631524Help
Entry
100631524         CDS       T02284                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aqu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 226 aa AA seqDB search
MTEKENMSGDCELTKRISLSQFDSQSTDWNDKEEKDEAKSKIDELSEVFRSVITLVGEDP
DREGLRATPLRAAKAFCYFTKGYEETVAGVVANGVFSEDHDEMVLVRDIDLYSLCEHHLV
PFYGKVSVGYLPLGKIIGLSKIARIVEMYSRRFQVQERLTKQIANAIIEAVQPRGVGVVV
EAVHMCMTMRGVSKPSSKTVTSSMLGVFRDDPKTREEFLALTGHTN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaagaaaacatgagcggtgattgcgaacttacaaaaaggatttctctttcg
cagtttgactcccaatccacagactggaacgacaaggaagagaaagatgaagcaaaatct
aaaattgacgagctttccgaagtttttcgttcagttatcacgcttgtaggtgaggatccc
gacagagaagggctgagggctactcctttgcgagcagctaaagctttttgctatttcact
aaaggatacgaggagaccgtagcaggtgtagttgctaatggtgtatttagtgaagatcac
gatgagatggttttagtccgtgacattgacctttattcattgtgtgaacatcatttggtt
ccattttatggcaaggtgtcagttggttacttaccattaggaaaaataataggactcagt
aaaattgcaaggatagttgagatgtatagcagaagatttcaagtccaagagagactcacc
aaacagatagccaatgctattattgaagctgttcaacctcgtggagtgggcgtggtcgtg
gaagctgtacacatgtgtatgacaatgaggggggtcagtaaaccatccagcaagacagtc
accagctcaatgcttggagtattcagagatgatccaaagaccagagaagaattccttgca
ctaacaggacatacaaactaa

DBGET integrated database retrieval system