KEGG   Amphimedon queenslandica (sponge): 100631534Help
Entry
100631534         CDS       T02284                                 

Gene name
Usp5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100631534 (Usp5)
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100631534 (Usp5)
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100631534 (Usp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 581 aa AA seqDB search
YAGSGGNNHALDYYNETKYPLAVKLGTITPGGADVYSYEEDSMVMDPKLSEHLSHFGINM
MIMSKTDKTMTELQIDANIKLGEWSVIQESGHELKLVYGPGYTGLQNLGNSCYMNSVMQV
LFALPEFKERYYDTAVDTFKRQTGDPTKDFNTQMCKLARGLLSGDYSKPLPPAEGSTPEG
EKEGQKEQEGIRPNMFKTLIGTGHREFSSNRQQDVQEFFLHLLSAIERAEHTSRGTRNVA
DLFKYQVEEKITCVVSGKVRYSVRPDSILTLPVPMETASNQAEVAAWKEKKAQLMAEKKK
INHDEAVRAKVSFSSCLGQYSSSTDIPDFYSTELKTKSPATRIYRFKTFPKYLVVQLAKF
AFDENWVPVKFDVEVDVPESLDISSLRGGGIQPGEVELPEESGPAQPEVEIDEGVLSQLA
GMGFDIEGCKRAIYHTKNQGIEPAMNWVLEHMGDPGVASEDSIAIVMSLGFTREQAMKAL
KATDNNVERAADWVFSHMDELQQMEEGEGEEPMEEEQFSDGSGKYSLIAFISHMGTSTMT
GHYVCHIKKDGKWIIFNDNKVAESVAPPKDHAYLYFYKREH
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
tatgcaggttctggtggtaacaatcatgcattggattattataatgaaaccaagtaccca
ttagcagttaaactgggtaccattactccaggaggagctgatgtctactcttatgaagaa
gactcaatggtgatggatcctaaactatcagaacacctctcacactttggaataaacatg
atgatcatgtctaaaactgacaagacgatgactgagttacaaatagatgctaatattaaa
ctgggggagtggtcagtgattcaggaatcaggccacgaactaaaactggtttacggtcct
ggttatactggtctacagaaccttggtaacagttgctacatgaattccgtcatgcaagtt
ctctttgcactgcccgagtttaaggagagatactatgatactgcagtggatacttttaaa
agacaaactggagacccaacaaaagactttaacactcaaatgtgtaaactggcccgagga
ttgttatctggtgattattccaaaccactccctcctgccgagggtagtaccccagaggga
gagaaagagggacaaaaggaacaagaaggtattcgtcctaacatgttcaaaacactcatt
ggcactggacacagagaattcagctccaacagacaacaagatgttcaagaatttttcctt
catcttctgtctgccatagagagagcagagcacactagtagaggtacaaggaatgttgct
gatttattcaagtatcaggttgaagagaagattacttgtgtcgtttctggtaaagtccgt
tattctgttagaccagactccatactaactttaccagttccaatggaaactgcctctaat
caagctgaagtggctgcttggaaagagaagaaagcacagctaatggcagagaaaaagaaa
attaatcatgatgaagcagtgagagctaaagtctctttctcatcttgtcttggacaatat
tcatcatctactgatattcctgacttctattcgacagaacttaaaacaaaatcaccagcg
accaggatttatcgttttaagacatttccaaagtatcttgttgttcagctagcgaaattt
gcttttgatgagaattgggtcccagtcaaatttgatgttgaagttgatgtccctgagtct
cttgatatatccagtctaagaggaggaggtatacaaccaggagaagttgaactacctgaa
gaatctggaccagcacaacctgaagttgagattgatgaaggtgtgttgtcacagttagcc
ggaatggggtttgacattgaaggctgcaagagagccatataccacactaagaaccaagga
atagagccagccatgaactgggtactggaacacatgggagaccctggtgtggccagtgaa
gactccattgctattgtaatgtcactgggtttcactagggaacaggctatgaaagcattg
aaagctacagataataatgtagaaagagctgctgactgggtgttcagtcatatggatgaa
ctacaacaaatggaagaaggagaaggtgaagaaccaatggaagaggaacagttcagtgat
gggtctggaaagtacagtctaatagcattcatcagtcatatgggtacctcaacaatgact
ggtcattatgtctgtcacattaagaaggatggcaagtggatcatatttaatgacaacaaa
gtagctgagtctgtggctccacctaaagatcatgcctacctctatttctacaagagagaa
cattga

DBGET integrated database retrieval system