KEGG   Amphimedon queenslandica (sponge): 100631534Help
Entry
100631534         CDS       T02284                                 

Gene name
Usp5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100631534 (Usp5)
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100631534 (Usp5)
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100631534 (Usp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 595 aa AA seqDB search
SGGNNHALDYYNETKYPLAVKLGTITPGGADVYSYEEDSMVMDPKLSEHLSHFGINMMIM
SKTMTELQIDANIKLGEWSVIQESGHELKLVYGPGYTGLQNLGNSCYMNSVMQVLFALPE
FKERYYDTAVDTFKRQTGDPTKDFNTQMCKLARGLLSGDYSKPLPPAEGSTPEGEKEGQK
EQEGIRPNMFKTLIGTGHREFSSNRQQDVQEFFLHLLSAIERHTSRGTRNVADLFKYQVE
EKITCVVSGKVRYSVRPDSILTLPVPMETASNQAEVAAWKEKKAQLMAEKKKINHDEAVR
AKVSFSSCLGQYSSSTDIPDFYSTELKTKSPATRIYRFKTFPKYLVVQLAKFAFDENWVP
VKFDVEVDVPESLDISSLRGGGIQPGEVELPEESGPAQPEVEIDEGVLSQLAGMGFDIEG
CKRAIYHTKNQGIEPAMNWVLEHMGDPDFTDPFVPPGSVKSAGGGADKGGVASEDSIAIV
MSLGFTREQAMKALKATDNNVERAADWVFSHMDELQQMEEGEGEEPMEEEQFSDGSGKYS
LIAFISHMGTSTMTGHYVCHIKKDGKWIIFNDNKVAESVAPPKDHAYLYFYKREH
NT seq 1790 nt NT seq  +upstreamnt  +downstreamnt
gttctggtggtaacaatcatgcattggattattataatgaaaccaagtacccattagcag
ttaaactgggtaccattactccaggaggagctgatgtctactcttatgaagaagactcaa
tggtgatggatcctaaactatcagaacacctctcacactttggaataaacatgatgatca
tgtctaaaacgatgactgagttacaaatagatgctaatattaaactgggggagtggtcag
tgattcaggaatcaggccacgaactaaaactggtttacggtcctggttatactggtctac
agaaccttggtaacagttgctacatgaattccgtcatgcaagttctctttgcactgcccg
agtttaaggagagatactatgatactgcagtggatacttttaaaagacaaactggagacc
caacaaaagactttaacactcaaatgtgtaaactggcccgaggattgttatctggtgatt
attccaaaccactccctcctgccgagggtagtaccccagagggagagaaagagggacaaa
aggaacaagaaggtattcgtcctaacatgttcaaaacactcattggcactggacacagag
aattcagctccaacagacaacaagatgttcaagaatttttccttcatcttctgtctgcca
tagagagacacactagtagaggtacaaggaatgttgctgatttattcaagtatcaggttg
aagagaagattacttgtgtcgtttctggtaaagtccgttattctgttagaccagactcca
tactaactttaccagttccaatggaaactgcctctaatcaagctgaagtggctgcttgga
aagagaagaaagcacagctaatggcagagaaaaagaaaattaatcatgatgaagcagtga
gagctaaagtctctttctcatcttgtcttggacaatattcatcatctactgatattcctg
acttctattcgacagaacttaaaacaaaatcaccagcgaccaggatttatcgttttaaga
catttccaaagtatcttgttgttcagctagcgaaatttgcttttgatgagaattgggtcc
cagtcaaatttgatgttgaagttgatgtccctgagtctcttgatatatccagtctaagag
gaggaggtatacaaccaggagaagttgaactacctgaagaatctggaccagcacaacctg
aagttgagattgatgaaggtgtgttgtcacagttagccggaatggggtttgacattgaag
gctgcaagagagccatataccacactaagaaccaaggaatagagccagccatgaactggg
tactggaacacatgggagaccctgattttacggatccatttgttcctcctggtagtgtca
agtcagcagggggtggggctgataaaggaggtgtggccagtgaagactccattgctattg
taatgtcactgggtttcactagggaacaggctatgaaagcattgaaagctacagataata
atgtagaaagagctgctgactgggtgttcagtcatatggatgaactacaacaaatggaag
aaggagaaggtgaagaaccaatggaagaggaacagttcagtgatgggtctggaaagtaca
gtctaatagcattcatcagtcatatgggtacctcaacaatgactggtcattatgtctgtc
acattaagaaggatggcaagtggatcatatttaatgacaacaaagtagctgagtctgtgg
ctccacctaaagatcatgcctacctctatttctacaagagagaacattga

DBGET integrated database retrieval system