KEGG   Amphimedon queenslandica (sponge): 100631560Help
Entry
100631560         CDS       T02284                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100631560
Translation factors [BR:aqu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100631560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 674 aa AA seqDB search
MADFDDDDDFSDPEGFEEDISDEELLGDLLKKRPTLDTDEDTLVVIDNAPKVKPELMEKL
KRILKKVVGKFGTIISEYYPVDENNIFKGYFFIEYATREEALNAVKTCDGYKLDKNNIFS
VNLFTDFDQYLGKLDSKWVEPKKEEFVEIGNLRSWLLDPDCHDQFAVIYDAPRNNMNAIC
RNTPQEPSIVCERKSWTDTYLQWSPLGSYLTTFHAQGVALWGTDEFKRIGKFTHSRATLA
DFSPCERYIVTLSNVVDNPNDPHQVIIWDVRNGEMKRSFKKLSNEEWPVIKWSFDGKYFA
KKGDDVLSIYESSNFGLLDKKSIVVRGIKDFSWSPSDYLISYWVPELGELPSKIIITRIP
SRQEVATKSRHLVSECKLQWHKQGDYLCVKVDHWVNKSKKQQVSCFELFHARENEIPVDS
IEIKEPVIDFSLEPNGSKLAIIHGEPPTRISVSFYKINEKGTPPAKLKIFEKQASNNLFW
SPAGQFIVLAGLKSMDGQLEFIDTSDMSLMNRQEHTKLTDITWDPTGRYVVSSLSFWSEK
MDTGFIMWSFQGKLLYRSPRYMERFCQFVWRPRPPSLLSEEDIKTIKKDFKKYQYLFEQK
DRSIKTKASKGLMEKHKKETEDFRAFQEKKKKDILRRQEMHNDYMKELESKLASSNEIIE
TSFLVKEKREKVDV
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttgatgatgatgatgacttttctgatcctgaaggcttcgaagaagatatt
agtgatgaagaattgttgggggatttacttaaaaaaagacctactttagatactgatgaa
gacactcttgttgttattgacaacgctcctaaagtgaagcctgaactaatggagaagctt
aaaaggattttgaagaaagtcgtggggaaatttggtaccatcatatcagaatattatcct
gtcgatgagaataatattttcaagggttattttttcatcgagtatgccactcgtgaggaa
gcactgaatgctgtcaagacatgtgatggatacaaattggacaaaaacaacatattctct
gtgaacttgttcaccgattttgaccaatatttaggaaagctggacagtaaatgggttgag
ccaaagaaagaagagtttgttgaaattggtaacctgaggtcgtggctccttgatcctgac
tgccatgatcagtttgcagtgatatatgatgctcctcgtaacaacatgaacgccatttgt
cgtaacacgccacaagaaccaagcattgtttgtgaacgaaagagttggactgatacgtat
ctccagtggtctcctttggggtcctaccttacaacgtttcacgctcagggtgtggctttg
tggggtactgatgaatttaaacgtatcggaaagtttacgcattctcgagctactttagct
gatttttctccttgtgaaaggtacatagtgacattaagtaatgtagtcgataatcctaat
gatcctcatcaagtgattatatgggatgtaaggaatggagaaatgaagagatcctttaag
aagctttctaatgaggagtggcctgtcattaagtggagttttgatggcaagtattttgct
aagaaaggcgatgatgtgctcagtatttatgaaagctctaattttggattgttggacaaa
aagtcaattgtagtgagaggaatcaaagatttttcctggtcccctagtgactatcttata
tcgtactgggtaccagagttaggggaactcccttctaagattatcatcacccgcatccca
tcccgtcaagaggtggccactaaaagtcgccacttagtctctgaatgtaagcttcagtgg
cataagcagggcgattatttgtgcgtcaaggttgatcactgggtcaataaatcaaaaaag
caacaagtgtcgtgttttgagttgtttcacgctagagagaatgagataccagttgactcc
attgagataaaagagccggtgattgatttctcgttggagcccaatggatcaaaactagct
atcattcacggggaacccccaacacgaatatcagtcagtttctataagatcaatgagaag
ggaacgccacctgcaaaactcaaaatatttgagaagcaagcttcaaacaatttgttctgg
tcccctgctggtcagtttattgtcctagcaggactgaagagtatggatggtcagttggag
ttcatagatacgtctgatatgtcactgatgaatagacaggagcacacgaagctgactgat
ataacttgggatcctactggacgatacgttgtctcgtctcttagtttctggtcggagaag
atggacactggttttatcatgtggtcatttcaaggcaagctcctctaccgtagcccacgg
tatatggagcgattctgtcagtttgtttggaggccgagaccgccatctttactgagtgaa
gaagacatcaaaactataaagaaagatttcaaaaagtaccagtacctatttgaacagaaa
gatcgttccattaagaccaaagcttcaaagggtttaatggaaaagcataaaaaggaaacg
gaagatttcagagcattccaagagaaaaagaagaaagatattttaagacgtcaagaaatg
cacaacgactacatgaaagagttagagtccaagttggcttcgtcgaacgaaatcattgaa
acgagtttcttggtcaaagagaagcgtgaaaaagttgacgtttaa

DBGET integrated database retrieval system