KEGG   Amphimedon queenslandica (sponge): 100631861Help
Entry
100631861         CDS       T02284                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100631861
   04142 Lysosome
    100631861
Exosome [BR:aqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100631861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1693 aa AA seqDB search
MAQNLPIKFQEHLQLQNVGINVSQIGFSSLTMESDKYICVREKVGDTSQVVIIDLGDPAN
PIRRPITAESAIMNPASKVIALRASGKNLQIFNIEMKSRMKSHTMTEDVTFWKWISLNTL
VLVTETSVFHWSMEGDSQPQKMFDRHSSLAGCQIINYRIDKNFTWLLLIGISAEAHRVKG
NMQLYSVERKVSQPIEGHAAGFAQLKLAGNPEESTLFSFAVRGAAGAKLHVIEVGTPATG
NQPFQKKAVDVFFPPEAQADFPVAMQISEKFGVAYLITKFGYIHLYDIESGTCIYMNRIS
GETIFVTAVHEPSSGIIGVNRKGQVLSVSVDEVNIVPYISNQLSNPDLALRFATRNNLAG
AEELFVRKFNMLFAQQNYSEAAKVAATSPKGILRTAETIQRFQTVPAPPGQQSPLLQYFG
ILLENSQLNKYEALELCRPVLVQGKKQLVEKWLKEEKLECSEELGELVKQVDPTLALSVF
LRAGVPAKVIQCFAETGQFNKIILYAKKVNYTPDYGFLLRHIMRMSPEKGVEFAKMLVPE
EGEPLVDINSAVDVFMELNMVQQCTSFLLDALKNNRPNEGPLQTRLLEMNLLTAPQVADA
IMGNQMFTHYDRPHIAQLCEKAGLLQRALEHYTDTYDIKRAVVHTHMLNPEWLVNYFGSL
SVEDSLDCLRAMLQANIRQNLQVVVKIASKYYEQLSTNSLIELFESFKSFEGLFYFLGSI
VNFNQDPDVHLKYIQAACKTGQMKEVERICRESNCYEPERVKNFLKEAKLTDQLPLIIVC
DRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPIVVGGLLDVDCTDDVIKNLVLTVRG
SYSTDELVEEVEKRNRLKLLLPLLESRVHEGVEEPATHNALAKIYIDSNNNPERFLKENH
FYDSHVVGKYCEKRDPHLACVAYERGQCDQELIQVCNENSLFKTEARYLVHRKDPELWAT
VLDEGNQYRRPLIDQVVQTALNETQDPEDVSVTVKAFMSADLPNELIELLEKIVLENSVF
SEHRNLQNLLILTAIKADQTRVMEYITRLDNYDAPDIASIAISSELFEEAFAIYKKFDVN
TSAIEVLINHISNLDRAYEFAERCNQPGVWSLLAAAQLSAMMIKEAIDSYIKADDPSCYT
EVINAANQGGNFEDLVRYLQMARKKTRETFIETELVFAFAMTNRLADLEEFISGPNHAQI
SQVGERCFNEGMYEAAKILFNNISNFARLASTLVHLGEFQNAVDSARKANSTRTWKEVCF
ACVDSSEFRLAQVCGLHIVVHADELGDLINYYQNRGHFNELITLLEAALGLERAHMGMFT
ELAILYSKYKPGKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAILAM
MAHPTVAWKESLFKDIVTKVANVELYYKALQFYLDHKPLLLNDLLIVLTPRLDHTRAVTF
FRKTNNMHLVKPYLRSVQQNNNKAINEALNQVLIEEEDFEDLRKSIDSFDNFDTIALAQQ
LERHDLIEFRRISAYLYKSNNRWSQSVELCKRDHLYKDAMQFACESRDPEVSENILAWFL
EIGKPECFAACLYTCYDLLKPDIILELAWRHNILDFAMPYLCQVLREYITKIDKLQLSDE
VRTAEAEEQQQQPPPMMMEAPLMITAGVGMGGGMPPPGMGSMGPAGMMPPTGQPPIGMPF
QPPQQPGGYFGQF
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaatctgccgattaaatttcaggagcatctccagctccaaaatgtaggcatc
aatgtctcccagattggtttctccagcctcactatggagtccgacaagtacatatgtgtg
agggaaaaggttggagacacttctcaagttgtcatcattgatcttggagatcctgctaat
cctattagacgtcccataactgctgagtcagcgattatgaatcctgcttccaaagtcatc
gcactcagagcttctggcaagaatcttcagatatttaacatcgaaatgaagagtaggatg
aagtcacacacaatgacagaagacgtgacgttctggaaatggatcagccttaataccctt
gtcctagtcacagagacatcagtcttccattggtccatggaaggtgattcacagccacag
aagatgtttgatcgtcactctagtttagccggttgtcagatcataaattacaggatagac
aagaacttcacttggcttttgctgattggcatttctgcagaggcccatcgagtcaaaggg
aacatgcagctgtattctgttgaacgaaaagtcagtcaacccattgaaggacatgcagct
ggctttgcacagttgaagttggccgggaacccagaggagtctacccttttttcttttgct
gtccgtggggcagctggagctaagttacacgttattgaagttggtactcctgctactgga
aaccaaccattccaaaagaaagccgtagatgttttctttcctccagaggcacaagctgat
ttccccgttgccatgcagataagtgagaagtttggtgtagcctatctcatcactaagttt
ggttacattcatctctatgacattgagtctggcacatgtatttacatgaatcgtatcagc
ggagagacgatatttgtcacagctgtacacgaaccatccagcggaatcattggcgtcaac
aggaagggacaggttctgtcagtgagtgttgatgaggtcaatattgtcccctacatatca
aaccagctgtccaatcctgatcttgccctccgttttgccaccaggaacaatctagccgga
gccgaggagcttttcgtccgaaagttcaacatgttgtttgcccaacagaattactctgag
gctgcaaaagttgctgctaccagccccaagggaatcctccgtactgctgaaaccatccag
aggttccagacggtcccagctcccccaggacagcagtctcctctcttgcagtattttggt
attctcctagagaacagtcaactcaataaatatgaggcccttgaactctgcaggccagtc
ctcgttcagggaaagaaacagctggttgaaaaatggctcaaagaagaaaagttagagtgt
tcagaggagctgggagaactggtcaaacaggttgatccaacccttgctctctcagtcttc
ctccgtgcaggagtaccagcaaaagttatacaatgctttgccgagactggtcagttcaac
aagatcattctctacgccaagaaagtcaactacactccagactatggcttcctcctccgt
cacatcatgagaatgagcccagagaaaggagtcgagtttgctaagatgctcgtaccagaa
gagggagagccactcgttgatatcaattccgccgtagacgtcttcatggagctgaacatg
gtccagcagtgcacctcgttcttgttggatgctttaaagaacaatcgtccaaacgaagga
cccctccagacccgcctcttggaaatgaatctactcacggccccacaagttgccgatgct
attatggggaatcagatgttcactcattacgatcggccccacattgctcagctctgtgag
aaggccggtctccttcagagggctctggagcactacactgatacttacgatatcaagaga
gctgttgtccacactcacatgcttaacccggagtggctcgttaattactttgggtcgctc
agtgttgaggattccctggattgtcttcgtgctatgctccaagctaacatcaggcagaat
ctacaagttgttgttaaaattgcctccaagtactacgagcagctctcaaccaattctctc
attgagctctttgagtctttcaagagttttgaaggattgttttatttcttgggatcaatt
gtcaactttaatcaggaccctgacgtccatttgaaatatattcaagctgcatgcaagact
ggacagatgaaggaggttgagcgaatctgccgtgaaagcaattgctatgaacctgaacgt
gttaagaactttttgaaggaggccaagctgaccgatcagctccctctcattattgtctgt
gacaggtttgattttgtccacgatctcgtcctctacctctatcgcaacaatcttcagaaa
tacattgaaatctatgttcagaaggtgaatccgtctcgtttacctattgttgttggtggt
ctccttgatgttgattgcaccgatgacgtcattaagaacctcgtcctaacagtccgtggc
tcctattccactgatgaactggtggaggaagtggagaagaggaatcgtcttaaactcctc
cttcctctccttgagtctcgggtccacgagggagtggaggaaccagccactcacaacgct
cttgctaagatttatattgacagcaataacaaccctgagaggttcctcaaagagaatcat
ttctatgatagtcatgttgttggtaaatattgcgagaagagggaccctcatttagcttgt
gttgcttacgaaaggggacagtgtgaccaggagctgatacaggtttgcaatgaaaactct
ctcttcaagaccgaggctcgttacctcgtccaccgcaaggaccccgagctatgggccacg
gtccttgacgagggcaaccagtaccgccgcccactcatagaccaagtggtccagactgct
ctgaacgagacccaagacccagaggacgtctctgtcaccgtcaaggctttcatgagcgcc
gacttgcccaacgaattgatcgagctcctcgagaagattgtccttgagaactctgtcttc
tctgagcaccgaaaccttcagaaccttttgatactcacagccataaaggctgaccagacc
cgcgtgatggagtacatcactcgtttggataattacgatgctcctgatattgccagcatt
gccattagcagtgagctctttgaagaggccttcgctatttataagaaatttgatgtcaat
acgtctgccattgaggttctcatcaaccacatcagtaatcttgatcgagcttacgagttt
gccgaaaggtgtaaccagcccggggtatggagccttcttgctgctgcccaactctctgcc
atgatgataaaggaagccattgattcttacataaaagctgacgatccttcttgctacact
gaagtcatcaacgcagctaatcaaggaggtaattttgaggatcttgtccgttacctgcaa
atggctcgtaagaagacccgagagactttcattgagacggagctggtctttgcctttgct
atgacgaaccgtttggccgatctggaggaattcatctctggacctaaccacgcccaaata
tctcaagttggtgagcgttgtttcaacgagggcatgtatgaagctgctaagattctcttt
aacaatatttccaatttcgctcgtttggcctctactcttgttcacttgggcgagttccag
aatgccgtggactccgcccgtaaagcaaactcaactaggacctggaaagaagtctgtttt
gcttgtgttgattccagcgaattccgtcttgctcaagtctgtggtctccatattgttgtt
cacgccgatgaactgggcgaccttatcaactactaccaaaaccgtggacacttcaacgag
ctcatcaccctcctggaggctgccctgggcctggagagagctcacatgggcatgttcact
gagctggccatcctttactcaaagtacaagcctgggaagatgagggagcatttggagctg
ttctggtctcgtgttaatataccaaaggtcctaagggcagcagagcaggcccacctctgg
tctgagctagtcttcctctatgataaatatgaggagtatgataacgccatactagcaatg
atggctcacccaaccgttgcttggaaggaaagcctcttcaaggacattgtcaccaaagtc
gccaacgttgagctttactacaaagcactccagttctacctagaccacaagccactccta
ctcaacgaccttctaatagtcctcactccacgcttggaccatactcgtgctgtcactttc
ttccgaaagacgaataacatgcaccttgtgaagccgtaccttcgctccgtccaacagaac
aataacaaggctatcaacgaggctctgaaccaggtccttatagaagaggaggactttgag
gacttgaggaagtcgatagattcttttgataactttgatacaattgctctcgctcagcaa
ctcgagagacacgatctcatagagttccgtcgtatctctgcctacctttacaagagtaac
aatcgttggagccagtctgttgagctttgtaagagggaccatttgtacaaggatgcaatg
cagtttgcttgtgagtcccgtgatcctgaagtcagtgagaatatccttgcctggttcctt
gaaatcggaaagcccgagtgttttgctgcctgcctctacacttgctacgacctcttgaaa
cctgacatcatactagagctggcttggaggcacaatatactggactttgctatgccttat
ctctgtcaagtacttagggaatatatcaccaaaattgacaagcttcagttaagtgatgaa
gttagaacagccgaagctgaagaacagcaacagcaacccccaccaatgatgatggaggct
ccattgatgatcactgctggtgttggaatgggaggaggtatgcctccacctggtatgggt
agtatgggtccagctggtatgatgccgcctactggacagcctccaatagggatgcccttc
cagcccccacagcagcctgggggctacttcgggcagttttaa

DBGET integrated database retrieval system