KEGG   Amphimedon queenslandica (sponge): 100631933Help
Entry
100631933         CDS       T02284                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aqu00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 283 aa AA seqDB search
MTLSALKMSKIEIRRDSSNCAVVNLHGATLQSWVHEGTEMIFVSKKSVFDNKKAIRGGIP
VVFPCFGVWELGPQHGFARISKWSLLEEPTKDSNGDVKAVFELSDDDNTRSLWNNKFKLS
YTVCVMSSGLFTELSVNNLNDSEPFSFTWLLHTYFAVPDVTKCTISGLSCLTYKDKVDEG
KEKKEVNDLVTISGFTDRVYKEASENHVITNVAGGKTVLLKKSNFPDTVVWNPWIEKAKS
MSDFGDDEYPYMVCVEAGYVANSCTVNAGSSYTSSQTIDVVSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgagtgccttaaagatgagtaagatagaaattcgccgtgattcttctaactgt
gctgttgttaatctacatggagctacattgcagtcatgggttcatgagggtacagaaatg
atatttgtcagcaagaagagtgtatttgataacaaaaaagcaatacgtggaggaatacct
gttgtctttccttgctttggtgtttgggaattaggtcctcaacatggctttgcacgtata
tcaaaatggtctttacttgaggagccaacaaaggatagtaatggtgatgtgaaagctgta
tttgaactttcagatgatgataatacacgatcattatggaacaacaagttcaaattatca
tatacagtctgtgtgatgtcatctggtttgttcactgagctttctgttaacaatcttaat
gacagtgaacccttttcctttacgtggctacttcatacttattttgctgttcctgatgtc
acaaagtgtactatttctggcctctcttgccttacatataaggataaagttgatgaagga
aaggaaaagaaagaggttaatgatcttgttactatatcaggctttactgacagggtgtat
aaagaagcaagtgaaaatcatgtcataacaaatgtagctggaggtaaaacagttctttta
aagaaatctaatttcccagacacagttgtctggaatccatggattgagaaagcaaaatca
atgagtgattttggagatgatgaatatccttacatggtgtgtgttgaagctggttatgtt
gctaatagctgtacagtcaatgctggatcttcatacacatcttcacagaccattgatgtt
gtatccaaatga

DBGET integrated database retrieval system