KEGG   Amphimedon queenslandica (sponge): 100631983Help
Entry
100631983         CDS       T02284                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial-like
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100631983
   01212 Fatty acid metabolism
    100631983
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100631983
   00650 Butanoate metabolism
    100631983
  Lipid metabolism
   00062 Fatty acid elongation
    100631983
   00071 Fatty acid degradation
    100631983
   01040 Biosynthesis of unsaturated fatty acids
    100631983
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100631983
   00310 Lysine degradation
    100631983
   00380 Tryptophan metabolism
    100631983
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100631983
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100631983
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100631983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 763 aa AA seqDB search
MANIVKLVSRLPKAYTVPLSSSLRWYTVPTSAASRKHIRCEIKNNVAVVKLDQADSKVNT
LSKELSDELVQTLNEIIDNPEAKAAVIISAKPGSFIAGADIGMLDSAKSDKELQEISKNG
QSMIQKMEDNKKPVVAAINGQCLGGGLEVAMGCHYRIATKHPKTFVGQPEVMLGLLPGAG
GTQRLPRLVGLPDSLDMMLTGKNVRADKAKKLGLIDLLVDPLGPGVASPEERTMQYLEEV
AINTANALANGTMSLPSRERSWTSMKGLMYNLTTHQKHVRNYVFKQARTKVLKLTNGLYP
APMKIMECVRVGLEKGLAEGYEAESIGFRELGMGSQSKALKSLFFGQTKCKKNRFGAPSK
PINNVAVLGAGLMGAGIVQVSLQKGYNVILKDKDEEGLSRGYQQIYKGINGRVRKRAMTK
FERDRTMSNLSTQLDYQGFNRADIVIEAVFEDLGLKHRVIKEVEEVVPPHCVFASNTSAL
PIADIAKGSKRPELVVGMHYFSPVDKMPLLEIITTDKTTKEASAIAVDVGLKQGKTVIVV
KDGPGFYTTRCLAPMLAEAIRLLQEGLGPANLDKYSKDYGFPVGLATLADEVGLDVAMHV
AKDLSSKFGTRFGGSDIGVLEDLVGRGFLGRKSGKGCYVYTDKKNRSVNTEAEELLQKYQ
ISLAGSHEVEEVQLRLISRFVNEAIYCLQEGILSDPVDGDIGAVFGLGFPPFRGGPFRFT
DSFGAQNLLDKINQFREVYGEHFEPAPLLVDYAKDPSKKFYPK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatcgtaaagcttgttagtaggctgccaaaggcatatacagtgcccctctct
tcctctctaagatggtacacagtgcctacttctgctgctagtcgaaagcatatcaggtgt
gaaatcaagaacaatgtcgctgttgtgaaacttgaccaagcagattcaaaggttaacact
ctctcaaaggaactatctgatgaactagttcaaactttaaatgaaatcatagataatcct
gaggccaaagcagctgtcatcatatcggcaaagccagggagctttatagccggagctgat
attgggatgcttgactcagcaaaatcagacaaagaattgcaagaaatctcaaaaaacgga
cagtctatgatccagaaaatggaagataacaaaaaacctgtggtggctgccattaatgga
cagtgtcttggaggagggctagaagttgccatgggttgtcattatcgcatagcaacaaag
cacccaaaaaccttcgttggacagcctgaggttatgcttggtcttttaccaggagctggt
ggaacacaaagactacccagactagttggcttaccggattccctcgatatgatgttaacg
ggcaaaaacgtcagagctgacaaagcaaagaaactcggacttattgatcttctggtagac
ccactcggccctggtgtggcgagccctgaagaaaggaccatgcagtatttggaggaagtt
gccatcaacactgcaaatgcattggccaatgggaccatgtcccttccctcgagagagagg
agctggactagcatgaaaggactaatgtacaatcttactactcaccagaaacacgtccgt
aactatgtcttcaagcaagcaaggactaaagtgctcaaactgaccaacgggctttaccca
gcaccgatgaagataatggagtgtgttcgagtcggtctcgagaaaggtcttgccgaggga
tacgaggctgagtccattggtttcagagagttggggatggggagccagtcaaaggcactc
aagagtttgttctttggacagaccaagtgtaagaaaaaccggttcggggccccctcaaaa
ccaattaataacgtcgccgtcctgggggctgggctcatgggagccggtatagtacaggtt
agtctacaaaaaggttacaatgttatcctaaaggataaagacgaagagggtctatcaaga
ggctatcaacagatatacaaagggattaatggtagggttcgcaaaagggccatgactaaa
tttgagcgagacaggaccatgtcaaacctgtctacacaactggactatcagggtttcaat
agggcggacattgtgatagaagctgtgtttgaggacctaggtttaaagcacagggtcatc
aaggaagtggaagaagttgttccccctcactgtgtctttgcctctaacacctcagctctc
ccaatagcagacattgctaagggaagcaagagaccggaattggttgttggtatgcattat
ttctctcctgttgataagatgccacttcttgagattattacaacagacaagacaaccaaa
gaagcttccgctattgctgttgatgttggtttaaaacaaggtaaaactgtcattgttgta
aaagatggtcctggattttacaccacaagatgtcttgctcctatgctagctgaggccatt
agactattacaggaaggtcttggcccggctaatttggataaatattcaaaagattatggt
tttcccgttggtcttgctacactagcagacgaagtggggctggacgttgctatgcacgtt
gctaaggacctcagctcaaaatttggtaccaggtttggaggctctgatataggagtgctt
gaagatttagtcggtcgtggatttttaggtcgtaagtccggtaaaggttgctacgtttac
actgataaaaagaacagaagtgtcaatactgaagccgaggaattactacagaaatatcaa
atatcattggctggcagtcatgaggtggaggaggttcaattgagactgatctcaaggttt
gtcaatgaggctatatactgcctccaggaagggatactcagtgatccggttgatggggac
attggagctgtctttgggttaggattcccgccattcagaggaggtccttttaggtttacc
gactcatttggtgctcagaacctgcttgacaagataaaccagttcagggaagtgtacggg
gagcactttgagcctgccccacttctggttgactatgctaaagatcctagcaaaaagttt
tatcccaaataa

DBGET integrated database retrieval system