KEGG   Amphimedon queenslandica (sponge): 100631995Help
Entry
100631995         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 351 aa AA seqDB search
MAAGEWCLIESDPGVFTELIRGFGVSGVQVEEVWSLDNDILLNLKPVHGLIFLYKWRPDD
NVQGSIVEDSRIRDIFFARQEIKNACATQAVLSVLLNVTHSDVELGSVLTDFKEFAASFS
PTDRGLSLTNSDQIRKVHNSFARQQMFEFDDSLSKGGEDVFHFVAFVPINGRLYELDGLK
TGPIDHGATDSTDWLNTVRPILEKRMQSYSAGEIHFNLLALVSDKRAVYKKEIVKLDTRK
ELAAKKIQSVLSGGGESMEDNSGLPDDPEQLQVIIEEAEGEVIRLNELIRIENDKMETYR
LENIRRRHNYLPLIMELLKTLAKKGRLVSLCEEAKKRKKSQTTADKAKEVK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggtgagtggtgtctgattgagagtgatccaggagtcttcactgaattaatt
agaggatttggagtaagtggtgtacaggttgaagaagtttggagccttgacaatgacatt
ctattgaacctcaaaccagtccatgggttgatattcctgtacaagtggcgtccagatgac
aatgttcaggggagtattgttgaagacagtcgaatcagagacatcttctttgctagacag
gagatcaagaatgcttgtgctactcaagcagtgctcagtgtattactgaatgtgactcat
tccgacgttgagttaggatcagtgctaactgatttcaaagaatttgctgcttcattctca
ccaacagatcgtgggcttagtctaactaatagcgaccaaataaggaaagtacataatagt
tttgcaagacagcaaatgtttgagtttgacgactcattatctaaaggaggtgaagatgtg
tttcattttgttgcttttgttccaattaatggccgactttatgaactggacggattaaag
acaggccccattgatcatggagcaactgacagtaccgactggctaaatacagtgagacca
atactggagaaaagaatgcaaagttacagtgctggcgagattcatttcaacttgttagca
cttgtaagtgacaagagagcagtttataaaaaagaaatagtaaagttggacactaggaaa
gaattggctgctaaaaagatccaaagtgttctttccggaggtggtgagtcgatggaagat
aattcaggtttacctgatgacccagagcaacttcaagtgatcattgaagaggccgaggga
gaagtgattagactcaatgaattaatacgaattgaaaatgacaaaatggagacttataga
ttggagaatattcgtaggcgtcacaactacctcccgttaataatggagctattgaagact
ctggctaagaaaggacgattagtgtcactttgtgaagaggcaaaaaagagaaaaaaatct
caaactactgctgacaaggcaaaggaagtgaagtaa

DBGET integrated database retrieval system