KEGG   Amphimedon queenslandica (sponge): 100632088Help
Entry
100632088         CDS       T02284                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100632088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 498 aa AA seqDB search
MPGYDLKINGEYARIESLQCSSCELILKDAIQNEDGQRFCKSCWEEAISSSSKAQKLGIN
PKEEIHPDIAVRREIDRLPVLCENYENGCDWTGKLKDHEHDHKAICEYKTMRCPLGCGKR
IPLGKLRKHEKEECPFRQVRCQYCRSELLAGDYDDHLLNCPNAPYTCGHCHTEMPRSEIH
KSLSKHPNPISHLENDQVFMHLQMLGLAMKRLETHFNVALKDIKKELTEIDESNSKFKDK
MINESSSLTKQVKQLEERLKGEPSNRIIIELQGEVTKLAERVSKVESGASYRPLNQGYDD
MSTSDSKMGGSIEHKLAEQERTSGMLKVHLSELELQLQASLASTYNGSFLWRIPDVKRRK
RDAIEGKITSIYSPPFYTGRNGYKMCIRAYLNGDGIGYNTHLSIFFVLMKGEYDPLLKWP
FDFKVSLIMVDQDHKRHIVQTFKPSPSSSSFQRPKSDMNIASGCPKFAELKILDNESYVK
EDVMYVKAIVDTTRIFHP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctatgacttgaagattaatggtgagtacgcccggatagagtccctccagtgc
tcctcatgtgaactgatactaaaagacgctatacaaaatgaagatggtcaaaggttttgt
aagagctgttgggaagaagcaatttcctctagttcaaaagctcaaaaattggggattaat
ccaaaggaagaaatacaccctgatattgctgttagaagagagatagataggctcccagtt
ttatgtgaaaactatgagaatggttgtgattggactggaaagcttaaagaccatgagcat
gatcacaaagctatctgtgagtataagaccatgaggtgtcctcttggctgtggtaagaga
attcctcttggaaaattgagaaaacatgaaaaagaagagtgtccgtttcgacaagtccga
tgtcaatattgcagaagtgaattattagctggagactatgatgatcaccttttgaactgt
cctaatgctccttatacttgtggtcattgtcacactgaaatgcctagaagtgaaatacac
aaaagtttatcaaagcacccaaatcctataagtcatttggaaaatgatcaagtcttcatg
catctccaaatgcttggactggctatgaagagattggagacacattttaatgtagcactg
aaggatattaaaaaagagcttacagagattgatgaaagtaattctaaattcaaggataaa
atgattaacgagagttcctcactaacaaaacaagtgaaacaactcgaggaacgtcttaaa
ggagaaccttcaaaccgaatcataatagaattacaaggagaagttacaaaactagctgaa
agagttagtaaggttgaatctggagcaagctaccgccctcttaaccagggctatgacgac
atgtcaacaagtgatagcaaaatgggaggatcaatcgagcacaaattagcagagcaagaa
aggacgtctgggatgttgaaagttcatctatcagaactggagttacaattacaagcttct
cttgcttctacctacaatggctcattcttgtggcgcatacctgatgtcaaacgaaggaaa
agagatgcaattgaggggaaaattacatcaatctatagtccacctttctacactggacga
aatggttataagatgtgtattcgtgcctatcttaatggagatggaatcggatataatact
catctatccatattttttgtcttgatgaaaggtgaatatgacccattattgaagtggcct
tttgatttcaaagtgtctttaatcatggtggatcaagaccacaagaggcacattgtgcaa
accttcaagccgtctcctagctcaagtagcttccagagaccaaaatcagacatgaacatt
gcatctgggtgtccaaaatttgccgagttaaaaatcctcgacaatgaatcatacgtaaaa
gaagacgttatgtatgttaaagcaattgttgatactactaggatttttcacccctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system