KEGG   Amphimedon queenslandica (sponge): 100632088Help
Entry
100632088         CDS       T02284                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like isoform X1
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100632088
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100632088
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100632088
Ubiquitin system [BR:aqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100632088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 540 aa AA seqDB search
MPGYDLKINGEYARIESLQCSSCELILKDAIQNEDGQRFCKSCWEEAISSSSKAQKLGIN
PKEEIHPDIAVRREIDRLPVLCENYENGCDWTGKLKDHEHDHKAICEYKTMRCPLGCGKR
IPLGKLRKHEKEECPFRQVRCQYCRSELLAGDYDDHLLNCPNAPYTCGHCHTEMPRSEMV
SHMLLNCREQLSCSGCQQQIHKSLSKHPNPISHLENDQVFMHLQMLGLAMKRLETHFNVA
LKDIKKELTEIDESNSKFKDKMINESSSLTKQVKQLEERLKGEPSNRIIIELQGEVTKLA
ERVSKVESGASYRPLNQGYDDMSTSDSKMGGSIEHKLAEQERTSGMLKVHLSELELQLQA
SLASTYNGSFLWRIPDVKRRKRDAIEGKITSIYSPPFYTGRNGYKMCIRAYLNGDGIGYN
THLSIFFVLMKGEYDPLLKWPFDFKVSLIMVDQDHKRHIVQTFKPSPSSSSFQRPKSDMN
IASGCPKFAELKILDNESYVKEDVMLLPKADQQDIGMSSIPVRPLSVYAHFGDNSSLKCS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctatgacttgaagattaatggtgagtacgcccggatagagtccctccagtgc
tcctcatgtgaactgatactaaaagacgctatacaaaatgaagatggtcaaaggttttgt
aagagctgttgggaagaagcaatttcctctagttcaaaagctcaaaaattggggattaat
ccaaaggaagaaatacaccctgatattgctgttagaagagagatagataggctcccagtt
ttatgtgaaaactatgagaatggttgtgattggactggaaagcttaaagaccatgagcat
gatcacaaagctatctgtgagtataagaccatgaggtgtcctcttggctgtggtaagaga
attcctcttggaaaattgagaaaacatgaaaaagaagagtgtccgtttcgacaagtccga
tgtcaatattgcagaagtgaattattagctggagactatgatgatcaccttttgaactgt
cctaatgctccttatacttgtggtcattgtcacactgaaatgcctagaagtgaaatggtt
agtcacatgttacttaactgcagagaacaattgtcttgctctggatgtcaacaacagata
cacaaaagtttatcaaagcacccaaatcctataagtcatttggaaaatgatcaagtcttc
atgcatctccaaatgcttggactggctatgaagagattggagacacattttaatgtagca
ctgaaggatattaaaaaagagcttacagagattgatgaaagtaattctaaattcaaggat
aaaatgattaacgagagttcctcactaacaaaacaagtgaaacaactcgaggaacgtctt
aaaggagaaccttcaaaccgaatcataatagaattacaaggagaagttacaaaactagct
gaaagagttagtaaggttgaatctggagcaagctaccgccctcttaaccagggctatgac
gacatgtcaacaagtgatagcaaaatgggaggatcaatcgagcacaaattagcagagcaa
gaaaggacgtctgggatgttgaaagttcatctatcagaactggagttacaattacaagct
tctcttgcttctacctacaatggctcattcttgtggcgcatacctgatgtcaaacgaagg
aaaagagatgcaattgaggggaaaattacatcaatctatagtccacctttctacactgga
cgaaatggttataagatgtgtattcgtgcctatcttaatggagatggaatcggatataat
actcatctatccatattttttgtcttgatgaaaggtgaatatgacccattattgaagtgg
ccttttgatttcaaagtgtctttaatcatggtggatcaagaccacaagaggcacattgtg
caaaccttcaagccgtctcctagctcaagtagcttccagagaccaaaatcagacatgaac
attgcatctgggtgtccaaaatttgccgagttaaaaatcctcgacaatgaatcatacgta
aaagaagacgttatgttgctacctaaagcagaccaacaagatattggtatgtctagcata
ccagttaggcctctgtctgtatatgcacattttggagataattcatcattaaaatgttct
taa

DBGET integrated database retrieval system