KEGG   Amphimedon queenslandica (sponge): 100632128Help
Entry
100632128         CDS       T02284                                 

Definition
mitogen-activated protein kinase 1-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aqu04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aqu04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aqu04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:aqu04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 356 aa AA seqDB search
MATVKPPPEIVRGQAFDVGPRYSNLSYIGEGAYGMVCSAVDNQSLTKVAIKRITPFEHQT
YCQRTLREIKILTRFRHENIIGILDILKPPSMAEMKDVYIVQTLMETDLYKLLKTQHLSN
DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPEQDHTGI
LTEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILNV
IGSPTEKDLSCIRNEKAKSYLKNLPFKPTVPWSRLYPKADPKALDILGKMLTFNPDERIS
VDAALAHPYLEQYYDPDDEPVAEVPFKFEMELDDLPKDRLKQLIYEETMNFHPHAV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtcaagcctcctccagagatagtccgcgggcaagcattcgacgtagggccc
cgatattcaaacctttcttatattggagagggtgcatatgggatggtttgttctgcagta
gataaccaatcattaaccaaagtggccatcaaaaggataaccccgtttgaacatcagaca
tattgtcaaaggacactaagagagataaagatcctaactagattccgccacgaaaatata
attggtatactggacatactcaagccgccatccatggcagaaatgaaagatgtttacatt
gtccagacactaatggagactgatctttacaaactgctcaagacacagcacctcagcaat
gatcacatttgttacttcctctatcagattctccgtgggttgaaatacatacattctgct
aatgtactacatcgtgatttgaagccaagcaatcttcttcttaataccacctgtgatctc
aagatatgtgattttggtctggcgagaatagcagatcctgagcaagatcataccggtata
ctaactgagtatgtcgccaccagatggtacagggctcctgaaataatgttgaattctaaa
ggatactccaaagccattgatatttggtctgttggctgtatcttggccgaaatgttgtca
aatcgcccgatattccctggaaagcactaccttgatcaacttaatcacatcttgaatgtg
attggatctccaacagagaaggacttgagttgtattaggaatgagaaagctaaaagctat
cttaaaaacttaccattcaagcccactgtaccatggtctaggctatatcccaaggccgat
cccaaagctcttgatatattaggcaaaatgttgacatttaatccagacgagcgcatatcg
gtggatgctgctttggcccacccatatttagagcagtactatgaccctgacgatgaacct
gtagctgaagttccctttaagtttgagatggagttggatgatttgcctaaggacagactt
aaacaattaatttacgaagagacaatgaactttcatcctcatgcagtttaa

DBGET integrated database retrieval system