KEGG   Amphimedon queenslandica (sponge): 100632187Help
Entry
100632187         CDS       T02284                                 

Definition
histone deacetylase 6-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100632187
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100632187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MEREKIVTREPSDLFDWNLASRKKDVRRKSSFTSQCVMTGIVYDERMKNHRNDNNPNHPE
CPERISSIWEQLVDDGVVECCRRIDARSATEQEILYVHSKTHYDEMVATENMSLEKLFQR
ALRLNSIYINPSSMQCALLAAGSVCEVTKLVIDETVDNGVAIVRPPGHHAESYTSMGFCF
FNNVAIAAKMAIEEYGVKRILIIDWDVHHGNATQHMFYDDNRVLYVSLHRHDNGGFYPGG
DEGDYDKVGKGKGSGYNVNIPWNLARMGDAEYMSAFYQIIMPIAFEYQPELVIVSSGFDS
GEGDPIGGYRVTPNGYAHMTHQLKSLADGKIVVALEGGYNLTTISHSMSAVVQVLLGDTP
RSLESCVPNDSALASIGNAAKCLSKYWKSLRHWQDQPVKGTVEEFAPLTSSSVVDPAPLT
DDSMSNSQADEMRGDDSIIIENGETPKSKPMPDESLKRSDEEILSEPPPPGTIPISSDSI
PLDVAQKALIQQLEDEGNACMFAVNPLSWCPHLESIVPIEGSLDTSALCETCSTPRENWV
CLTCQHVHCGRYINKHMLEHSEASGHNIVLSYADLSVWCFTCDSYVYNPVLFPFIKLASD
DKFK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggaaaagattgtaactagagaaccaagtgacttatttgactggaatctcgcc
agcaggaagaaagatgtaaggagaaagagttccttcactagccaatgcgttatgacgggt
attgtatatgacgagcgaatgaagaatcacaggaacgacaataatccaaatcatcctgag
tgccccgagaggattagctccatatgggaacagttggttgatgacggtgtggttgagtgc
tgtaggagaatagatgctagatctgccaccgagcaagagatattatatgttcacagtaaa
actcattacgatgaaatggtagcaactgagaacatgtctttggagaaattatttcaacga
gctcttcgtctcaattctatttatataaatccatcttcaatgcagtgtgctcttcttgct
gctggctctgtatgtgaagttacaaagctagtgattgatgaaactgttgataatggggtt
gctatagtgaggccgcctggtcatcatgcagagtcctacacgtcaatgggtttctgtttc
ttcaataatgtagccatcgctgccaaaatggctattgaagagtatggagtcaagaggatt
ctcattattgactgggatgttcatcatggcaatgcaacacagcacatgttctatgatgac
aacagggtcttgtatgttagtcttcatcgtcacgataacggtgggttctaccctggtggt
gacgaaggtgactatgataaagttggcaaaggcaaaggctccggctataatgtcaacata
ccttggaatctggctaggatgggtgatgccgaatacatgagtgccttctatcagatcata
atgccaattgcatttgagtaccagccagagcttgtaatagtttcgtcaggttttgattct
ggtgaaggagacccaataggaggttatagggttactcctaatgggtatgctcacatgacg
catcaattgaaatctctcgcagacggaaagattgttgtagctcttgaaggtgggtataat
ctcaccactatatcgcactcaatgtctgctgttgtgcaagttcttttgggcgacacacca
cgttcacttgagtcctgtgttcctaatgatagtgctcttgcttctattggtaatgctgca
aagtgtttatcaaaatactggaaatcactcagacactggcaagaccagccagtaaaaggg
acagtggaagagtttgctccattaaccagtagcagtgtagtagatccagcaccactgact
gatgatagtatgagcaacagtcaagcagatgaaatgagaggagatgattccattataatt
gagaatggtgagacccccaagtctaaacccatgccggacgaaagcctaaaaagaagcgat
gaagaaatactctcggagcctccacctcctggcactatccccatatcctctgactccata
ccattggatgtagcacagaaagcattaatacaacaactggaggatgaaggaaatgcctgt
atgtttgctgttaatccattgtcctggtgtcctcacttggagtccatagtaccaatagaa
gggtcgctggacacgtctgcattatgtgagacgtgtagtacaccacgtgagaactgggtc
tgtctcacctgtcagcatgtgcattgtggacgatacattaataagcatatgctcgagcac
agtgaagcttctggacacaatattgtattgtcgtatgctgatctttctgtttggtgtttc
acttgtgattcttacgtttataatcctgttctcttcccatttatcaaattggcaagtgat
gacaaatttaagtag

DBGET integrated database retrieval system