KEGG   Amphimedon queenslandica (sponge): 100632187Help
Entry
100632187         CDS       T02284                                 

Definition
histone deacetylase 6-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MEREKIVTREPSDLFDWNLASRKKDVRRKSSFTSQCVMTGIVYDERMKNHRNDNNPNHPE
CPERISSIWEQLVDDGVVECCRRIDARSATEQEILYVHSKTHYDEMVATENMSLEKLFQR
ALRLNSIYINPSSMQCALLAAGSVCEVTKLVIDETVDNGVAIVRPPGHHAESYTSMGFCF
FNNVAIAAKMAIEEYGVKRILIIDWDVHHGNATQHMFYDDNRVLYVSLHRHDNGGFYPGG
DEGDYDKVGKGKGSGYNVNIPWNLARMGDAEYMSAFYQIIMPIAFEYQPELVIVSSGFDS
GEGDPIGGYRVTPNGYAHMTHQLKSLADGKIVVALEGGYNLTTISHSMSAVVQVLLGDTP
RSLESCVPNDSALASIGNAAKCLSKYWKSLRHWQDQPVKGTVEEFAPLTSSSVVDPAPLT
DDSMSNSQADEMRGDDSIIIENGETPKSKPMPDESLKRSDEEILSEPPPPGTIPISSDSI
PLDVAQKALIQQLEDEGNACMFAVNPLSWCPHLESIVPIEGSLDTSALCETCSTPRENWV
CLTCQHVHCGRYINKHMLEHSEASGHNIVLSYADLSVWCFTCDSYVYNPVLFPFIKLASD
DKFK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggaaaagattgtaactagagaaccaagtgacttatttgactggaatctcgcc
agcaggaagaaagatgtaaggagaaagagttccttcactagccaatgcgttatgacgggt
attgtatatgacgagcgaatgaagaatcacaggaacgacaataatccaaatcatcctgag
tgccccgagaggattagctccatatgggaacagttggttgatgacggtgtggttgagtgc
tgtaggagaatagatgctagatctgccaccgagcaagagatattatatgttcacagtaaa
actcattacgatgaaatggtagcaactgagaacatgtctttggagaaattatttcaacga
gctcttcgtctcaattctatttatataaatccatcttcaatgcagtgtgctcttcttgct
gctggctctgtatgtgaagttacaaagctagtgattgatgaaactgttgataatggggtt
gctatagtgaggccgcctggtcatcatgcagagtcctacacgtcaatgggtttctgtttc
ttcaataatgtagccatcgctgccaaaatggctattgaagagtatggagtcaagaggatt
ctcattattgactgggatgttcatcatggcaatgcaacacagcacatgttctatgatgac
aacagggtcttgtatgttagtcttcatcgtcacgataacggtgggttctaccctggtggt
gacgaaggtgactatgataaagttggcaaaggcaaaggctccggctataatgtcaacata
ccttggaatctggctaggatgggtgatgccgaatacatgagtgccttctatcagatcata
atgccaattgcatttgagtaccagccagagcttgtaatagtttcgtcaggttttgattct
ggtgaaggagacccaataggaggttatagggttactcctaatgggtatgctcacatgacg
catcaattgaaatctctcgcagacggaaagattgttgtagctcttgaaggtgggtataat
ctcaccactatatcgcactcaatgtctgctgttgtgcaagttcttttgggcgacacacca
cgttcacttgagtcctgtgttcctaatgatagtgctcttgcttctattggtaatgctgca
aagtgtttatcaaaatactggaaatcactcagacactggcaagaccagccagtaaaaggg
acagtggaagagtttgctccattaaccagtagcagtgtagtagatccagcaccactgact
gatgatagtatgagcaacagtcaagcagatgaaatgagaggagatgattccattataatt
gagaatggtgagacccccaagtctaaacccatgccggacgaaagcctaaaaagaagcgat
gaagaaatactctcggagcctccacctcctggcactatccccatatcctctgactccata
ccattggatgtagcacagaaagcattaatacaacaactggaggatgaaggaaatgcctgt
atgtttgctgttaatccattgtcctggtgtcctcacttggagtccatagtaccaatagaa
gggtcgctggacacgtctgcattatgtgagacgtgtagtacaccacgtgagaactgggtc
tgtctcacctgtcagcatgtgcattgtggacgatacattaataagcatatgctcgagcac
agtgaagcttctggacacaatattgtattgtcgtatgctgatctttctgtttggtgtttc
acttgtgattcttacgtttataatcctgttctcttcccatttatcaaattggcaagtgat
gacaaatttaagtag

DBGET integrated database retrieval system