KEGG   Amphimedon queenslandica (sponge): 100632211Help
Entry
100632211         CDS       T02284                                 

Definition
NAD-dependent deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100632211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 287 aa AA seqDB search
MSVNYASRLSEYRDKGVCGVPEVYDAWEEVERKVSLLCEWLGSSSHAVAHTGAGISTSAG
IPDFRGPKGVWTLEKKGEKLDVDVHFEDALPTLTHLSLTKLVEKDIIKYIVSQNVDGLHL
KSGLDREHLSELHGNMFVEKCEKCSKEYVHDKVVPTIGLKYTGNRCTGGGARGRCRGKLR
DTVLDWEDDLPADDLSRAELHSTQSDLSLCLGTTLQILPSGKLPLRVKKNNGKLVICNLQ
PTQYDKKADLVIHYYVDDVMNCLMKKLNLTLAPYPPSTEEVKRAIDL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaattatgcctcaagactatcagagtacagggataaaggagtttgtggagtt
cctgaggtttatgatgcctgggaagaggtagagaggaaagtgagcctactttgtgaatgg
ttaggatcttcctcacacgctgtggcccatacaggagccggtataagcacttctgctggt
attcctgattttcgtggacctaaaggagtttggactttggaaaagaaaggagagaaactt
gacgttgatgttcactttgaagatgctcttccaacactcactcatttatcacttactaaa
ctggtggaaaaggatattattaaatacattgttagccagaatgttgacggcctccatctc
aaatcaggactagatagggaacatctttctgaattacatggtaacatgtttgttgagaaa
tgtgaaaagtgtagcaaagagtacgtccatgataaagtggtgcctacaataggactcaaa
tacactgggaatagatgtactggagggggagctagaggacgatgcagaggtaaattacgt
gacacagtattagattgggaagatgatttaccagctgatgatctatcacgagcggaactg
cactcaactcaatctgacctctcactctgtcttggtactacactccaaatacttccatca
ggcaaactgcctctaagggtaaagaagaataatgggaaactagtcatctgtaacctgcaa
ccaactcaatatgacaagaaagctgaccttgtaattcattattacgttgatgatgttatg
aactgtttgatgaagaaacttaatttgactttagcaccttatcctccctcaactgaggaa
gtgaaaagagcaatagatctataa

DBGET integrated database retrieval system