KEGG   Amphimedon queenslandica (sponge): 100632359Help
Entry
100632359         CDS       T02284                                 

Definition
uncharacterized LOC100632359
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100632359
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100632359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 817 aa AA seqDB search
MGNKKKRKSRVSSDGKKYQPGKGKDESTSAGKEGEAANKKQSKSFPVPGLNNLGNTCFFN
AVLQNLSQTHLLRQRMSQHLSVTSYSLSIPSGSDDLAPLEVTVKRNDEGAKTEDFAIDLY
RFLVDMNGMSNRILNPRIIFNHVCKSAPRFNSYQQQDSHELLRYLLDALKSEEIQRRKVA
ILKSYGVCKKPDKVKTLTDDDKKAIKLYGMQASMMDTYLEDVFGGKLTSSITCHSCQTCT
DMQEDILDLSLPIPSDKVLHRFPKSKRKPSIHSSDDDEGLSVQKGRGSRASLSKHQRKRQ
EKAEKKKAKGKNKQKGKYSLEEFNELKSDPPKLPKLEEETSGPGVPELVQQLNDITLEEP
VNTNGDVIRTNALIDSSSAVTDAPINIPGSPAANVALQSEASGVTFNHNTSVPDSTIDKE
HVQGEPPTPSVSIDVPEKEPEKIEDISNSAQTVDSSATVIDSSATVIDSSATVIDTGSIV
LENEPVPLDLSIEIVPTEPSGATPVVAKQKPAPPEEDNLFSLQSCLRDFTSPEILKGTEK
FCCNVCTEKARSTKSKGTAKKSKEESSPLSLAVSDQQQPEKLTEKLTVENKGTNNDEKVE
FSIDSGMNSSSSSSESDRDDSRDIESTKESDDEETAISDREENESECDLVFTEATKQLLI
DHPPRVLCIQLKRFTQLGRNLSSLQKNNAHIDFTFLLDIASYCTDKCTDYFDSDGRLMYS
LYGVVIHGGSMRGGHYTAYVRVRSEIQLERLTVNKVTESETINSDNEHIETRSFDYTSME
NSQWYYISDTQVSKASADDVSQSQAYLLFYERLPFSC
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaaaaagaagagaaagtctcgtgtttctagtgatggcaagaagtatcagcct
ggaaagggaaaagatgaatctaccagtgctggaaaggaaggagaagcagctaataagaag
caatctaaaagtttcccagttcctggattgaataatctaggcaatacatgctttttcaat
gcagttttacaaaacctgtctcagacacacttgttgagacaaaggatgagtcagcattta
tcagtcacgagctactctctttcaattccttcagggagtgatgatttggcacctttagaa
gtaacggttaagagaaatgacgaaggagcaaaaactgaagactttgctattgatttgtac
cgattcttggtggacatgaacggaatgagtaatcggattttgaatccacgaatcatcttc
aaccatgtttgcaagagtgctccaaggtttaatagctatcaacagcaagatagtcatgag
ctgctccggtatttactggatgctttgaagagtgaagagattcaaagaaggaaagttgcc
attttgaaatcgtatggcgtatgcaagaaacccgataaagtcaagaccctcactgatgat
gacaagaaagctattaaattgtatgggatgcaggcatcgatgatggacacctatcttgaa
gatgtttttggtgggaaattaacaagttctatcacatgccactcttgtcaaacatgtaca
gatatgcaagaagatattcttgatttgtctctccctataccttcagataaggtgcttcat
cgatttccaaaatccaaaagaaagccttctatccattcctctgatgatgatgaaggtttg
agtgttcagaagggaagaggctcgcgggcttctttgagcaagcatcagaggaagaggcaa
gagaaagccgaaaagaagaaagcaaaaggaaaaaacaagcaaaaaggaaagtatagtctt
gaggagtttaatgagttgaaaagtgaccctccaaagctacctaaactagaagaagagact
tcaggtcctggtgtacctgagctggtacaacagcttaatgacattacacttgaggagcct
gtgaatacaaatggtgatgtcattagaactaacgctcttattgatagctcatctgctgtc
actgatgctccaatcaacattcctggatcaccagcggcaaatgtcgccctgcaaagtgaa
gcatctggcgtcacttttaatcacaatacatcagtacctgattctactattgataaggaa
cacgttcaaggggaacctcctactcccagtgtttctattgatgtaccagagaaagagccc
gagaaaattgaagatatttctaacagtgctcaaactgttgattcttctgctacagtgatt
gattcttctgctacagtgattgattcttctgctacagtgattgatactggtagtattgtg
ttggaaaatgagccagtgcctttggatttatccattgagattgtcccaactgagcctagt
ggagccactcctgtagtagctaagcaaaaaccggcccctccagaggaagataacttattc
tctcttcagtcgtgtttgagggatttcacgtcgcccgagattctcaaaggaaccgaaaag
ttttgttgcaacgtgtgtactgagaaggctagaagtacgaagtctaaaggaactgcgaag
aaatcaaaggaagagtcttctccactgtcattggcagtttctgatcagcagcagcctgaa
aagctgacagaaaaattaactgtagaaaataaaggcaccaacaatgatgaaaaggttgag
ttcagtattgattctggtatgaattcgtcatcttcgagcagcgagtctgacagggacgat
tccagagatattgaaagcactaaagaatctgatgatgaagagacagcaatcagtgaccga
gaggagaatgaaagtgaatgtgatcttgtttttactgaagccacaaagcaactcttaata
gaccatccgcctcgtgtcctctgtatacaactaaaaagatttacacagcttggaagaaat
ctgtccagtttgcagaagaacaatgctcatattgatttcaccttcctattggatatagcc
tcctattgcactgacaaatgcacagattactttgattctgatggaagactcatgtattcc
ttatatggtgtagttattcatgggggtagcatgcgtggtggacactacactgcgtatgta
agagtgaggagtgaaatacagcttgagagactcacagtcaacaaagtgacagagtctgag
actattaatagtgataatgaacatattgagacacgatcatttgattatacatcaatggag
aatagccagtggtactacatcagtgatactcaagtgagtaaggcatcggctgacgatgtc
tctcaatctcaggcttatttattgttttatgaaagactccctttttcatgttaa

DBGET integrated database retrieval system