KEGG   Amphimedon queenslandica (sponge): 100632370Help
Entry
100632370         CDS       T02284                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aqu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aqu00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 460 aa AA seqDB search
MSSFAPSTKRSRTENGMEWKDSDEFFPGIPVIPYSPDASPDNVLCFRHYNPTQVVMGRSM
ADWLRFSACFWHSFRGTGADPFGFPTINRPWDDGTDTIENAKRRLRAGFEFFTKMGLKYW
TFHDRDIAPMGDTLEQTNKNLDEMTDLALELQNKTGVKLLWATCNLFAHPMYSNGASTSP
DAHVFAMAGAQVKKGLEVAKKLGAEGFVFWGGREGYQTLLNTDVRRELDHMGAFFKMVVA
YKKKIGFTGQLLIEPKPKEPTKHQYDYDAQTVISFLKTYGLDTDFKLNIEPNHTTLAGHG
HEHDVVVASKFGMLGSIDSNTGSPDLGWDTDQFPMEIKNTTLIMKAIIEQGGLAPGGLNF
DCKVRRESIDLQDLFIAHIGAMDSFARGLMCAVELFNQGVMEKCVKDRYSSYDSGIGSSI
ENGKASLEQLEEYIKANGFPTPTSGQQEMYEVLFNNALKY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttttgctccttctacaaagagaagcaggactgaaaatggcatggagtggaaa
gattcagatgaattttttccaggtatacccgtgataccatactctcctgatgctagccct
gataatgttctttgctttcgtcattacaatccaactcaagttgttatgggaaggtctatg
gccgactggttgcgtttctcagcttgcttttggcacagctttaggggaaccggggcagac
ccattcgggtttcccactatcaatagaccgtgggatgatggaactgatactattgaaaat
gccaagagaagattgagagctggttttgagttctttactaaaatgggtttgaagtattgg
acattccatgacagggatattgctccaatgggggacactcttgaacaaactaataagaac
cttgatgagatgaccgacttagcccttgagctgcagaataaaactggagttaaactttta
tgggcaacgtgtaacctctttgctcacccaatgtactccaatggagcgagcaccagtcct
gacgcacacgtatttgcaatggcaggagctcaagtgaagaaaggattagaagtagccaag
aaactaggagccgagggatttgtattttggggtgggcgtgaggggtatcagaccttactt
aatactgatgtcaggagggagctggatcacatgggagcatttttcaaaatggttgtcgct
tacaagaagaagataggattcactggccaattgcttattgagccaaaaccaaaagagcca
actaaacatcaatatgactacgatgcacaaactgtcatctctttcttaaagacgtatggc
cttgatacagatttcaagttaaacattgagcccaatcatactacactagcaggacatggt
catgaacacgatgtagtggtagcttcaaagtttggtatgcttggctccattgactccaat
acaggatcgcctgatctgggatgggacactgatcagttcccaatggaaattaagaacact
actttaataatgaaggctattattgagcagggcggactggccccagggggtcttaatttt
gattgtaaagttcgtagagaatcgattgatcttcaagatctatttatagctcatattggt
gctatggatagttttgctcgtggtttgatgtgtgctgtggagttgtttaatcaaggtgtg
atggagaaatgtgtcaaggatcgatattccagttatgatagtggaataggatcaagtatt
gaaaatggtaaagcaagtcttgagcagttggaggaatacatcaaagccaatggattccct
acaccaacttctggacagcaggagatgtatgaggtgttgtttaacaacgccttgaaatat
tga

DBGET integrated database retrieval system