KEGG   Amphimedon queenslandica (sponge): 100632483Help
Entry
100632483         CDS       T02284                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100632483
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100632483
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100632483
Enzymes [BR:aqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100632483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 503 aa AA seqDB search
MWNLKLGSRLFWLQHRLQLCRVYSQAQLIEQLPKAFSLESASTTSTVTQQIQRILKRFPS
EIRPISKMDDIPFTPEVLTNHILSYYKSICNDDSKKRLFYAYLVKHLGPDRADVHKAAKT
LTGMYSKEYYDSSKLLRAEIQLQNVLSPLYIEIFRWIVQKNGGLKALVDMRSDLLSIIRD
SNEEGTLVHDLKELDVHFRSLLSQWFSHGFLDLQQITWQSPCDIIEKVSEYEAVHSIRSW
KDIKHRVGPFRRVFILTHRNMPREPIIVLHSALTQSPSSSVQTLLNRQVHEIKSLDNVRS
AVFYSISAAHKGLSGIELGNSLILQVVEALKKEIPSLQQFVTLSPVPGFRKWLEAHLHSC
INDSRVFKISLEKLQELKILCPDQTNIHSFLQHVLDTNDWSATASARMNALKQPLMSLCA
KYLVNEKRRGFALNPVANFHIRNGASLWRLNWLADTSPKGLKDSYGIMANYKYDLSCMSE
YNQHYVLQGNIHFSDDVGKLLND
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatctaaagctaggatctcgtcttttctggctgcagcatcgcctacaactgtgt
agggtttactctcaggctcagcttattgagcaactgcctaaagcattttcattggaaagt
gcaagcactaccagtactgttacacaacaaatacagagaatccttaagaggtttcccagt
gaaattagaccaatctcaaagatggatgacattcctttcacacctgaggtattaacaaat
catattctatcatattacaagtctatatgtaatgatgactcaaaaaagagattgttttat
gcttaccttgttaagcatcttggtccagatcgtgctgatgttcataaagcagcaaagaca
ctcactggcatgtacagtaaagaatattatgattcaagcaaattactgcgggctgaaata
caattgcaaaatgtccttagtcctttgtatatcgaaatattccgttggattgtacaaaag
aatggaggattaaaagcgttggtggatatgaggagtgatttattgtcaatcatcagggac
agtaatgaagaaggcactctcgttcatgatctaaaagaattagatgttcattttcgatca
ttattgtcacaatggttctcacatggatttctagaccttcaacaaattacatggcaatct
ccttgtgacattattgaaaaggtcagtgaatatgaggctgtccattcaatacgctcctgg
aaagatataaagcatcgcgttgggccatttaggagagtatttattctaactcatcggaac
atgccaagagaaccaatcattgtcctccattccgcattaactcagtctccatcttcaagt
gttcagactttgttaaatagacaagtgcatgaaattaagagtctggacaatgtcagatca
gcagtgttttattcaatatctgctgctcataaaggactctctggtattgaacttggcaat
tctcttatacttcaagtagttgaagctctaaagaaagaaatccctagccttcagcagttt
gtgactctctctccagtacctggctttcgtaaatggttggaagctcatcttcattcctgt
attaatgattcaagagtattcaagatttcattggagaaacttcaagagctaaaaattctt
tgtcctgatcaaaccaacattcattctttccttcagcatgtactggatactaatgactgg
tcagctacagcatctgctagaatgaatgcattaaagcagccattaatgtccttatgcgca
aagtatcttgtaaatgaaaagagaagaggctttgctctcaaccctgttgctaattttcac
ataaggaatggagcttcactctggcgtctgaattggcttgcagatacaagtccaaagggt
ttgaaagactcatatggaataatggcaaattataagtatgacttgtcctgcatgagcgag
tacaatcagcactacgtcttacaaggaaatatacacttttctgatgatgtaggaaaactt
ttaaatgattaa

DBGET integrated database retrieval system