KEGG   Amphimedon queenslandica (sponge): 100632497Help
Entry
100632497         CDS       T02284                                 

Definition
(RefSeq) nuclear pore complex protein Nup205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100632497
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100632497
Chromosome [BR:aqu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100632497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1973 aa AA seqDB search
MSGGVWAPFKELSTVVHSAIALKQPQSYYQLEGILKKHKPDFISLLRNPAQNPSHRSQVK
NANKVGLALPNIPKPLVLPEDFIDEALILSDILDLNEIASVELLLAGEHHQPDFPSLSRG
LVSVLLYYDGRRNVVISLRTLIQGCEGISWTLGLEQNVVSLVTGFVQELFQNDLSGKITR
LLLDMNIEKELEKLNTGRAIKDSHHKQQIIDLIKETQQGLCDCLLYWGCQNPLPKDSLLK
ILLELKKVQSVGESHSPLDPPYLCLFLTFLVSLRVGESDCNLDSSLVDEHYPFLADMNSI
SLIHQEVTAKTPWANGGLAAAVKFAWAVFLRECSSLDAFKDCTELDHDEELIDEAIDSEA
FQFLRHSVLAATNFFQEEYHIKAIHHVLTSYIYLMPVKITELRNLGDEVAREETLRMLRG
GTAQALPKLNQSFGEFMLLIGELYANDPLELNLSLEFWPSSDPVTQSQHHRTLSLYKFIH
QCSDLLPPSLFHSFMTMLCGLSSSPLTACHCFEFLKSNSPSQGGGGPSAVISFDHFFQSL
KQYFLGLQQAAEPSSRTSTGCAISPQELDGLIIVLKLVALIVDLDENARILIYDSQTWLP
VATLFGLLSCPVSRQLKAQIFLTLSCFAKTPDIAASMWNTVEITQILNTTAGTAGRYGIG
PAQQEGSIQIELEEIESAAEEYYETRSFLSLLDRLTDIPLPPYLGSDHRVPGFQPYLQFV
QDSVFLKFDSRGYKDPQEKWTVASSALKILLKLVDQHELSHEDLIEQHYEIPGPAPVMGG
VGRSQFVTLPKLPGFNILLHLLNDTPLLRKLLYIISESYHLLSDVDSCTKEVEEASLLSL
KMIEVALNKQNNFLALLRSSTDHSMMATPLDSLLFGINPRSGQADHYLNITRYITLSKVS
PELSLVSVRIIGLASRSSVVGRDVLNSLLNDNEACVDIVHGFVEHLEVDEDSLTRTEAET
QRQLKEDIIRLLISCVLKRSRNIAHLLLGFEQAKENLGGHSKKLSDVILQDPGVLGSART
CLHSVLSLVKVGSSGSSSFPSPLGCHLTHPKLAELSYQLLYCLSASKEFGTPTLRYLRNN
HDYFYTQLSAVPFPWLPDDSEESAMSCYNQLSWILRSVAIELKVTVSINQRSHAQRLASL
LMKSNTTGLTQEELLMSWGEGQGEVPNEYSNNGRRKILSLLDLMDVSLLATPTLKLQYFD
EGRTEEVVRYCEREEGGVAYIDVKTLHNSLINELSGLQGAAALSQKPYILKEIHNILEVI
VRRNNINEISHSRQLYIESWQQVVEVLMSVVNEEGEKESLRIDVLFELIQDLLLKVEGTE
PNSLTAIIFSVIFTLMAHLRHTLSVSSEREQEQGNAVHLANAGPLQSILRRLLNNLLVCP
SGMQRLRSYLYATLLCYLNMTKERETELGSYRGGMWRLESDVSLGSINLSILSGCGDNLM
DTVCRDACSGHDVPKMLSLSILESIIFLDKHNVWLKFLISRGYLLSIVSSLQEENDSLQK
MLHPQPDALRPLYVYESKMAFLILVASTSLGARELVSKNCVSILSECRFIDQRPMHTATG
RGDGFIPSLWSRYLSLFLPVLRFLLSLLSTTGPQQKQATSQVIDFIASHNEIFVSCLKEG
SSSLSLTALQELSLVTAVVSQCRAGQDWMLKLAQTPNLLHLQNLVLSLLPFYMFPSKWTQ
QESDGWSNISGSLGAGASFEDQFDLSQKITTNLVLYCHNAVSLGGTESPSRGSRIIFSCD
LSKGNNALPGSSGLSLAVLVSSLEGMSDEYFNVREKLGQLESKLEGLKNMTSEEMKQLYS
DVTTDDTAQISPLQLHQQLKSVLNRLVSNKQQQLKHFIYTVEHLLSVLWSHLQFYLVHCQ
PTEEYHQQSISQFSSKPIRNLQGAGGQTSFSTRDGSNQFNVSSAGVTLKDLEELKLNAVS
SLSDSFFKKLLDVNEDYMSLNEELSMISFIEALVRRIRKLLKLRAAARPVLKL
NT seq 5922 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggtgtgtgggctccttttaaagagttatcaactgtagttcattctgcgatt
gcactgaagcagcctcaatcatactaccagttggaaggaatcctcaaaaagcacaaacca
gattttatatctttactcaggaaccctgcacagaatcctagtcatcgctctcaagttaag
aatgccaataaagtcgggttggccctaccaaacattccaaagccactggttcttcctgag
gactttatagacgaggctctcatcctcagtgatatcctagacctcaatgagatagcttca
gttgagctcctactagcaggagagcatcatcagcctgacttcccttctctctctcgtggt
ctagtctcggttttactgtactatgatggacgtcgtaatgttgtcatttctttgcgtact
cttatccaaggctgtgaagggatatcatggacgcttggattagaacaaaatgttgtttct
cttgtgactggttttgtccaagaattgtttcagaatgatctgagtggtaagatcacaagg
ttgctcttagacatgaacattgagaaagagctggagaaactcaatactggtagagctatt
aaagactcgcaccacaagcagcaaatcattgatctcattaaggaaacacaacaaggactc
tgtgactgtctgctgtactggggctgtcagaatccattaccaaaagactctcttttaaaa
atactcctcgaactcaagaaagtccagtccgttggtgaatcccatagtccactggatccg
ccctacctctgcttattcctcactttcctggtatccttgagggttggggagtcagactgc
aatcttgacagctcactggttgatgagcattatccatttcttgctgatatgaacagcatc
tcattgatacatcaagaggtgactgctaagactccctgggctaatggagggctggcagca
gctgtcaagtttgcttgggctgtcttcctcagagaatgttcatcactggatgcttttaaa
gattgtactgagttggatcatgacgaggaactcattgatgaagctatagattctgaagct
tttcagttcctaagacactcagtgttagctgcaactaatttctttcaagaggagtatcac
ataaaggccattcatcatgtactaacatcttacatatacctgatgcctgttaagattact
gagctacgtaatcttggagatgaagtggccagggaggagaccctccgtatgctgcgaggt
ggtacagctcaggcactccctaaactcaatcagagttttggtgaattcatgttgttgatt
ggagagctttatgctaacgatcctcttgagcttaatctctcacttgagttctggcctagc
agtgaccctgttactcagtcacagcatcatagaactttgagtttgtacaagtttattcat
cagtgttctgacctccttcctccctctctctttcactcgttcatgacaatgctctgtgga
ctctcttcttcacctctcactgcctgtcactgctttgaatttttaaaatctaatagtcct
agtcaaggtggtgggggtccatcagctgtgatttcttttgatcatttctttcagtcatta
aaacagtatttccttggtcttcagcaagcagctgaaccatcatcccgaacatcaactgga
tgtgccatatctccacaggaactcgacggtctcatcatagtccttaaacttgtggcacta
atagtggacctggatgagaatgctcgtatactgatttatgatagtcagacctggctacct
gttgccacactctttggtctgttaagttgtcctgtgtcaaggcaactgaaggcacagata
ttcctcactctgagttgctttgcaaagacgccggacattgcagcaagtatgtggaatact
gttgagattactcaaatactgaatacaactgcaggcactgctggtaggtatggtatagga
ccagcccaacaggagggaagcatacagatcgaattagaagagatagagtcagcagctgaa
gagtattatgaaacccgttcattcctgagtctcctggacagactgaccgatatcccccta
ccaccctacctgggctctgatcatagagtcccagggttccaaccttaccttcagtttgta
caggactctgtcttccttaagtttgacagtagaggatataaggacccccaggaaaagtgg
acagtagctagttctgctctcaagatattactcaagctagttgatcagcacgaactctct
catgaagatttgatagagcagcattacgagatcccaggaccagctcctgtaatgggagga
gtgggaaggagtcagtttgttactctacctaagctgccaggttttaatatactactccat
ttactgaatgacactcctttactgaggaaattgttgtatataatatctgagtcctatcac
ttactgtctgatgtggatagctgcactaaagaggttgaagaggcctccctcttgtccctc
aagatgattgaggttgctctcaataaacagaacaacttcctggccctactgaggagcagc
actgatcactctatgatggccacacctcttgatagtctactgtttgggattaaccctcgg
agcggtcaggctgatcattatctcaatataactagatacattacattaagtaaagttagt
ccagagttgtctctagtatctgttaggatcattggattagcttcaagatcatcagttgtg
ggacgtgatgtcttgaactcattacttaatgacaatgaagcttgtgttgatatagttcat
ggttttgttgagcacttggaggttgatgaagactctctgactaggactgaggctgaaact
caaagacagctaaaagaggacatcattagactattaatatcctgtgtgctgaagagatct
agaaacattgctcacctccttctcgggtttgaacaagctaaggaaaaccttgggggacac
tctaagaaactatcggacgttattcttcaggacccaggtgtgttgggttctgctagaacc
tgtctccattcagtcctcagtttagttaaagttggttccagtggttcctcctccttcccc
tctcctctcggctgtcacttgacccatcctaaactagccgagctctcctatcagttgctc
tattgtctttcagctagtaaagagttcggtacgcccacgcttcgttatttacgtaataac
cacgactacttctacactcaactctctgccgtcccgtttccatggttaccggatgacagt
gaagagagcgcaatgtcatgttataatcagttgtcatggatactccgatctgttgccata
gagcttaaagtgacagtaagtattaatcaaagatcacatgcccagcgattagcgagtctt
ttgatgaaaagcaacactactggtctaactcaagaagaactcctcatgtcatggggggag
gggcagggggaagtacctaatgaatattctaataacggtcgtcgaaagatactctctctt
cttgatctcatggatgtgtcgttgttggccacgcccactttaaagttgcagtattttgac
gagggacgtactgaggaggtggtgagatattgtgagagggaggaagggggcgtggcttat
attgatgtgaagactcttcataactcgttgattaatgagttgagtggattacaaggagca
gctgctctctcacagaaaccatacatactaaaggagatacacaatatattggaggttatt
gtgagaaggaataatatcaatgagatatctcattcacgccagctctacattgagtcatgg
cagcaggtggtggaggtattgatgagtgtagtcaatgaggagggggagaaagaatcactg
aggattgatgtgctttttgaattaattcaagatttactattaaaggttgaaggtactgaa
cctaattccctaactgccattatattttcagtgatattcacactaatggctcatctccgt
cacactctctcagtatcatcagagagagaacaagagcaaggtaatgctgttcatctagcc
aatgctggcccattgcagtctatactgaggagactgttgaacaacctcctggtctgtcct
tctgggatgcaacgacttcgttcttatctttatgctactcttctctgctacctcaacatg
actaaagagagggagacagaactaggcagctatcgtggtggtatgtggaggctggagagt
gatgtttcattgggttccattaatttgagtattctctctggctgtggggataacctaatg
gatactgtttgcagagacgcctgcagtggacatgatgtgcctaagatgctgtctctttca
attctggaatcaattatatttcttgacaagcataatgtttggttaaagttcctcatatca
agaggctatcttttaagtattgtatccagtcttcaagaagagaatgattcgttacagaag
atgttacacccacagcctgatgcattgagaccactctatgtatatgagtctaaaatggct
tttcttatccttgttgcatcaacctctcttggagcccgtgaattagtgtctaaaaactgt
gtatcgatcctctcagagtgtaggtttattgatcagcgccccatgcacacagctactggt
agaggagatggtttcataccctccttgtggtcgaggtatttgtcattgttcctgccagtt
ttgagatttcttctctcactgttatcaaccactggaccacagcagaaacaagcaactagt
caagtgattgatttcattgcttctcataatgagatatttgtctcatgcctcaaagaagga
agctcctctctctccttgacagctctgcaggaactctccctggttactgctgtagtcagc
cagtgcagggcaggtcaagactggatgttaaagcttgcccaaaccccgaacctccttcac
ttgcagaaccttgtcctctctctccttccattttacatgttcccttcaaagtggacccaa
caggaatctgatggctggagcaatatcagtgggagtcttggggccggagcttcattcgag
gaccagtttgatctctctcagaagataaccactaatttagttctttattgccataatgct
gtctctcttggaggcactgaatcaccttctagaggttcaaggataattttttcttgtgat
ctctcaaaggggaataatgcattgccaggttcatctggtttgtccctagcagtcctcgtc
tctagtcttgaagggatgagtgatgagtatttcaatgtgagagagaagctcggacaactt
gagagcaagttagaaggattgaagaacatgacatcagaagaaatgaagcaactttattct
gatgtgactactgatgacactgcccaaatctctcctttgcaattacaccaacagctcaag
tcagttctaaatagactcgtctcaaacaagcagcagcaactgaagcactttatttatact
gtggaacatttgttgtcagttctttggtctcatcttcagttttatttagttcattgtcag
ccaacagaagaatatcatcaacaatccattagtcagttctcaagcaaaccaatcagaaac
ttacaaggtgctggtggtcaaaccagtttttctacaagagatggtagtaatcagtttaat
gtctcatcggctggagttacactgaaagatttggaagagttgaagttaaatgctgttagc
tcattaagtgattcattctttaagaaactccttgatgtgaatgaggactatatgtcacta
aatgaagagctttcaatgattagtttcattgaagcgcttgtgagacgaataaggaaacta
ctcaaactgagggcagcagccagaccagtccttaaactatag

DBGET integrated database retrieval system