KEGG   Amphimedon queenslandica (sponge): 100632497Help
Entry
100632497         CDS       T02284                                 

Gene name
Nup205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100632497 (Nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1461 aa AA seqDB search
MSGGVWAPFKELSTVVHSAIALKQPQSYYQLEGILKKHKPDFISLLRNPAQNPSHRSQVK
NANKVGLALPNIPKPLVLPEDFIDEALILSDILDLNEIASVELLLAGEHHQPDFPSLSRG
LVSVLLYYDGRRNVVISLRTLIQGCEGISWTLGLEQNVVSLVTGFVQELFQNDLSGKITR
LLLDMNIEKELEKLNTGRAIKDSHHKQQIIDLIKETQQGLCDCLLYWGCQNPLPKDSLLK
ILLELKKVQSVGESHSPLDPPYLCLFLTFLVSLRVGESDCNLDSSLVDEHYPFLADMNSI
SLIHQEVTAKTPWANGGLAAAVKFAWAVFLRECSSLDAFKDCTELDHDEELIDEAIDSEA
FQFLRHSVLAATNFFQEEYHIKAIHHVLTSYIYLMPVKITELRNLGDEVAREETLRMLRG
GTAQALPKLNQSFGEFMLLIGELYANDPLELNLSLEFWPSSDPVTQSQHHRTLSLYKFIH
QCSDLLPPSLFHSFMTMLCGLSSSPLTACHCFEFLKSLKQYFLGLQQAAEPSSRTSTGCA
ISPQELDGLIIVLKLVALIVDLDENARILIYDSQTWLPVATLFGLLSCPVSRQLKAQIFL
TLSCFAKTPDIAASMWNTVEITQILNTTAGTAGRYGIGPAQQEGSIQIELEEIESAAEEY
YETRSFLSLLDRLTDIPLPPYLGSDHRVPGFQPYLQFVQDSVFLKFDSRGYKDPQEKWTV
ASSALKILLKLVDQHELSHEDLIEQHYEIPGPAPVMGGVGRSQFVTLPKLPGFNILLHLL
NDTPLLRKLLYIISESYHLLSDVDSCTKEVEEASLLSLKMIEVALNKQNNFLALLRSSTD
HSMMATPLDSLLFGINPRSGQADHYLNITRYITLSKVSPELSLVSVRIIGLASRSSVVGR
DVLNSLLNDNEACVDIVHGFVEHLEVDEDSLTRTEAETQRQLKEDIIRLLISCVLKRSRN
IAHLLLGFEQAKENLGGHSKKLSDVILQDPGVLGSARTCLHSVLSLVKVGSSGSSSFPSP
LGCHLTHPKLAELSYQLLYCLSASKEFGTPTLRYLRNNHDYFYTQLSAVPFPWLPDDSEE
SAMSCYNQLSWILRSVAIELKVTVSINQRSHAQRLASLLMKSNTTGLTQEELLMSWGEGQ
GEVPNEYSNNGRRKILSLLDLMDVSLLATPTLKLQYFDEGRTEEVVRYCEREEGGVAYID
VKTLHNSLINELSGLQGAAALSQKPYILKYNAFPDRAYQRRIKALEVHCIHCVKQCEWTG
KLEDLSAHLNHREKKELYRRYEGCSYTEIRCKHDSCFSCYVERRLLKDHEENCKHRPAIC
TYCSIFKGTFEQVESHHKTCGMFPVPCTNKDHKDFIIQRENLQHHLGTVCPFQPIDCQFK
WAGCNDRPKRKDERQHNATSQQDHLLLLAGACSQLKKENKELREQLEKDKEDLRKELKEA
NQKLDHLTQTSVKETRSYCTR
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggtgtgtgggctccttttaaagagttatcaactgtagttcattctgcgatt
gcactgaagcagcctcaatcatactaccagttggaaggaatcctcaaaaagcacaaacca
gattttatatctttactcaggaaccctgcacagaatcctagtcatcgctctcaagttaag
aatgccaataaagtcgggttggccctaccaaacattccaaagccactggttcttcctgag
gactttatagacgaggctctcatcctcagtgatatcctagacctcaatgagatagcttca
gttgagctcctactagcaggagagcatcatcagcctgacttcccttctctctctcgtggt
ctagtctcggttttactgtactatgatggacgtcgtaatgttgtcatttctttgcgtact
cttatccaaggctgtgaagggatatcatggacgcttggattagaacaaaatgttgtttct
cttgtgactggttttgtccaagaattgtttcagaatgatctgagtggtaagatcacaagg
ttgctcttagacatgaacattgagaaagagctggagaaactcaatactggtagagctatt
aaagactcgcaccacaagcagcaaatcattgatctcattaaggaaacacaacaaggactc
tgtgactgtctgctgtactggggctgtcagaatccattaccaaaagactctcttttaaaa
atactcctcgaactcaagaaagtccagtccgttggtgaatcccatagtccactggatccg
ccctacctctgcttattcctcactttcctggtatccttgagggttggggagtcagactgc
aatcttgacagctcactggttgatgagcattatccatttcttgctgatatgaacagcatc
tcattgatacatcaagaggtgactgctaagactccctgggctaatggagggctggcagca
gctgtcaagtttgcttgggctgtcttcctcagagaatgttcatcactggatgcttttaaa
gattgtactgagttggatcatgacgaggaactcattgatgaagctatagattctgaagct
tttcagttcctaagacactcagtgttagctgcaactaatttctttcaagaggagtatcac
ataaaggccattcatcatgtactaacatcttacatatacctgatgcctgttaagattact
gagctacgtaatcttggagatgaagtggccagggaggagaccctccgtatgctgcgaggt
ggtacagctcaggcactccctaaactcaatcagagttttggtgaattcatgttgttgatt
ggagagctttatgctaacgatcctcttgagcttaatctctcacttgagttctggcctagc
agtgaccctgttactcagtcacagcatcatagaactttgagtttgtacaagtttattcat
cagtgttctgacctccttcctccctctctctttcactcgttcatgacaatgctctgtgga
ctctcttcttcacctctcactgcctgtcactgctttgaatttttaaaatcattaaaacag
tatttccttggtcttcagcaagcagctgaaccatcatcccgaacatcaactggatgtgcc
atatctccacaggaactcgacggtctcatcatagtccttaaacttgtggcactaatagtg
gacctggatgagaatgctcgtatactgatttatgatagtcagacctggctacctgttgcc
acactctttggtctgttaagttgtcctgtgtcaaggcaactgaaggcacagatattcctc
actctgagttgctttgcaaagacgccggacattgcagcaagtatgtggaatactgttgag
attactcaaatactgaatacaactgcaggcactgctggtaggtatggtataggaccagcc
caacaggagggaagcatacagatcgaattagaagagatagagtcagcagctgaagagtat
tatgaaacccgttcattcctgagtctcctggacagactgaccgatatccccctaccaccc
tacctgggctctgatcatagagtcccagggttccaaccttaccttcagtttgtacaggac
tctgtcttccttaagtttgacagtagaggatataaggacccccaggaaaagtggacagta
gctagttctgctctcaagatattactcaagctagttgatcagcacgaactctctcatgaa
gatttgatagagcagcattacgagatcccaggaccagctcctgtaatgggaggagtggga
aggagtcagtttgttactctacctaagctgccaggttttaatatactactccatttactg
aatgacactcctttactgaggaaattgttgtatataatatctgagtcctatcacttactg
tctgatgtggatagctgcactaaagaggttgaagaggcctccctcttgtccctcaagatg
attgaggttgctctcaataaacagaacaacttcctggccctactgaggagcagcactgat
cactctatgatggccacacctcttgatagtctactgtttgggattaaccctcggagcggt
caggctgatcattatctcaatataactagatacattacattaagtaaagttagtccagag
ttgtctctagtatctgttaggatcattggattagcttcaagatcatcagttgtgggacgt
gatgtcttgaactcattacttaatgacaatgaagcttgtgttgatatagttcatggtttt
gttgagcacttggaggttgatgaagactctctgactaggactgaggctgaaactcaaaga
cagctaaaagaggacatcattagactattaatatcctgtgtgctgaagagatctagaaac
attgctcacctccttctcgggtttgaacaagctaaggaaaaccttgggggacactctaag
aaactatcggacgttattcttcaggacccaggtgtgttgggttctgctagaacctgtctc
cattcagtcctcagtttagttaaagttggttccagtggttcctcctccttcccctctcct
ctcggctgtcacttgacccatcctaaactagccgagctctcctatcagttgctctattgt
ctttcagctagtaaagagttcggtacgcccacgcttcgttatttacgtaataaccacgac
tacttctacactcaactctctgccgtcccgtttccatggttaccggatgacagtgaagag
agcgcaatgtcatgttataatcagttgtcatggatactccgatctgttgccatagagctt
aaagtgacagtaagtattaatcaaagatcacatgcccagcgattagcgagtcttttgatg
aaaagcaacactactggtctaactcaagaagaactcctcatgtcatggggggaggggcag
ggggaagtacctaatgaatattctaataacggtcgtcgaaagatactctctcttcttgat
ctcatggatgtgtcgttgttggccacgcccactttaaagttgcagtattttgacgaggga
cgtactgaggaggtggtgagatattgtgagagggaggaagggggcgtggcttatattgat
gtgaagactcttcataactcgttgattaatgagttgagtggattacaaggagcagctgct
ctctcacagaaaccatacatactaaagtataatgctttccctgaccgtgcttatcaaaga
agaataaaagcattagaagttcactgcatacactgtgtgaagcagtgtgagtggactggc
aaactggaagatttatctgctcaccttaatcaccgtgagaagaaggagctatatagacga
tatgaaggatgtagctacactgaaattagatgcaagcatgattcttgcttctcgtgttat
gtggagcggaggttgctaaaagatcatgaagaaaactgcaaacaccgaccagcgatatgt
acttattgtagcatttttaaaggcacttttgagcaagtagaatcccatcataaaacttgt
ggtatgtttcctgtgccttgtacaaataaagatcacaaggacttcattattcagcgagag
aatcttcagcatcatcttggcactgtttgcccattccaaccaatagattgccagtttaag
tgggctgggtgcaatgataggccaaagcgtaaagatgagcgccagcacaatgctactagc
caacaggaccacttactactgctagctggggcttgctcacaattgaaaaaagaaaacaaa
gaattaagggaacaattggaaaaggataaagaagatttgaggaaggaactgaaagaggcc
aatcaaaagctggatcatcttactcaaactagtgtgaaagagactcgatcatactgtaca
cggtga

DBGET integrated database retrieval system