KEGG   Amphimedon queenslandica (sponge): 100632649Help
Entry
100632649         CDS       T02284                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 10-like isoform X2
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 946 aa AA seqDB search
MADTGAVEEFIAKSKNLAPVQSQESTSEDWESLAPGVDPTDYQPKDTPIIPPPPPPPPVD
SGRVPNLLSVSGKKDIEDLLAEPGVCGLINLGNTCYMNSGLQSLRSIPQLTQFYLNNVHP
VASTPTKKEGEAVVEEEEEKERLERERGPEDQKDGEGEKDEDKTGKKDKSKDIKTLTQGH
ISARFSALIQKTWAGQFSAIVPQSFKTTLGLRYPQFSGYRQQDCQEFLVLLLDCLHEDII
NQFPLKSCMEKRDGSDNEGQVEETRSVITSTFQGQLKNEVTCSVCGHVSVKCDPFVYLSV
PIPHSNEQQITIFWSSVTGSSRSIEKLLVIIPILSTVNDLKTSLCQLLEEGEGERGEEED
GGGGVSIVPDSVILAHVKEHSIVSTLGNALSIKHVIKDEYKVYAFQVGSPPSTKAIPEVT
ATPQRDGYERITDDEVPMETDSSPRQPASEDGLPFKIPRSDEADEATPLLEEAEPTVVVM
EWHSCVICLEEMVDSELLTHSVCGAMICDTCLQASRNHSGTENGLMPCPVCKSMVTLEEG
FVPLAAPDKSDDIVRLLQLTVLFRNKVDDTWVLFGHPCLLNVPASASIDKYYQLISPLLP
EQCRQYPWSLALTDGKGRYCSRCLFGSGCGGCVLTNAMTDVNLKPGDFFSISFTNLPSTV
VQEADSFRSHSSLDSLWPSSVSLQDCLDLFSQKETLGQDNPWFCSKCNMNQTAVRQLLIS
QLPTTLIVHLKRFLFHGNTASKVETGVNFPLSLSLSSSSSSAPTDYSLVSCVCHFGTLNS
GHYTNYSKQPVSHKWYYYNDETVSEITPSDKDNESAYILFYHRQDSNTFDFPSKKDITFP
TQEEELVELEPLLRALKPKPPPAPLPPPLPPIKKSSSTGNLAADTSDNDIQLQQQIAASL
GLDIPAMSTPGPSPLKPSSSNPTLPAEQFSEPVVFKSAHFKSFDAS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggcggatactggtgcagtggaagagtttatagcaaagagcaagaacctggctccagtt
caatcgcaggaatcaacctcagaagactgggagagtcttgccccaggggtagatcccact
gactaccagcccaaggacacgcccattatcccgccccctcctcctccccctcctgttgat
tccggtcgtgttcctaatttactttctgtttctgggaagaaagatatcgaagatttgttg
gcggaacctggtgtgtgtggcttgattaatctagggaacacctgttacatgaattcaggc
cttcaatcacttcgcagcataccacaactcacacaattctatttgaataatgttcatcct
gttgcctcaactccaactaagaaagaaggagaagctgtagtagaagaagaagaagaaaaa
gagagattagagagagaaaggggtcctgaggatcagaaagatggggaaggagagaaagat
gaggacaagactggtaaaaaagataaatctaaagacataaagacattaacacaggggcac
atcagtgctaggttttccgccttaatacagaagacttgggccggacagttctcggccatt
gtaccacagtcatttaaaacgacacttggacttcggtatccgcaatttagcgggtataga
cagcaagactgtcaggagtttttagttttattgctcgactgtcttcatgaagatatcatc
aaccagtttccattaaagagttgcatggagaagagagatggatcagataatgaaggccaa
gttgaggagactcgatctgtcattaccagcacatttcaaggacaattgaaaaatgaagtt
acatgttcagtgtgtggtcatgtatcagttaagtgtgatccctttgtgtatctctcagtt
cctatccctcactctaatgaacagcaaataactattttctggtcttcagtaactggaagc
agtagatcaattgaaaagttattggtcatcattccaatattgagtacagtcaatgatcta
aagacatctctctgtcagttactagaagaaggagaaggagagagaggagaagaagaagat
ggagggggtggtgtgtccatagtacccgatagtgtaatcttggctcatgttaaagaacac
tcaatagtatctactctaggtaatgcgttatccattaaacatgtcatcaaagatgaatat
aaagtctatgcatttcaagttggttctcctcctagtactaaagcaatacctgaagttact
gccactcctcaacgtgatggatatgaaagaattactgatgatgaagttcccatggaaact
gactcctcccctcgacaaccagcctctgaagacggactcccttttaaaatcccacgtagc
gatgaagctgacgaggccacgcccctattagaagaggcggagccaacagtagttgttatg
gagtggcactcctgtgttatttgtttggaggagatggttgatagcgaattattgacacac
tcagtttgtggagccatgatatgtgatacctgcttacaggcgtctcggaatcactctgga
accgagaatgggctcatgccgtgtccagtttgtaagtcaatggtgacactagaggaaggt
tttgttcctctagcagctcctgataaatctgatgacattgttagattattacagttgact
gttctctttcgcaataaagtcgatgatacttgggtcctctttggacacccttgtcttcta
aatgtaccagcgtcagcgagcattgataaatattatcagttgatatcacctttgttacca
gagcagtgtcgccagtatccatggtcccttgctctgacggatggaaagggtcggtattgc
tcacgctgtctgtttggtagcggctgtggtgggtgtgtccttactaatgcaatgactgac
gtaaatctgaaaccaggagacttcttttctatctcattcactaacttaccatccactgta
gtacaagaggccgactccttcaggtcccactcatctcttgatagtctttggccgtcgtct
gtttccctacaggactgccttgatcttttctctcaaaaggaaacgttgggacaggacaac
ccttggttttgctcgaaatgcaatatgaatcagactgcagtgagacagttactgatatca
cagctaccaactacacttattgtccatcttaaaagattcttgtttcatggtaacacagct
agtaaggttgagaccggtgtcaatttccctctctccctctccctctcatcatcttcatct
tcagcaccaactgactactcacttgtcagctgtgtctgccattttggaacattaaattcc
ggtcattatactaattattctaaacagccagtctctcataagtggtattattacaatgat
gaaaccgtgtctgagataacaccatcagataaagataacgagagtgcctatatattgttc
tatcatagacaagattctaatactttcgattttccaagtaaaaaggacattacttttcca
actcaagaggaagaattggttgagctagagcctttactgagagccttaaaacctaaacca
ccacctgctcctcttccccctccccttcctccaatcaagaaatcctctagcacaggaaac
ttggctgccgacactagtgataatgatattcagctccagcagcagattgccgcctcccta
ggtcttgatataccagccatgtccactccaggtccttctcctttgaaaccttcatcctct
aacccgacactacctgcagaacagttttcagaaccagtggtttttaaatcagctcatttt
aagagcttcgatgcatcatag

DBGET integrated database retrieval system