KEGG   Amphimedon queenslandica (sponge): 100632649Help
Entry
100632649         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 32-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100632649
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100632649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 908 aa AA seqDB search
MADTGAVEEFIAKSKNLAPVQSQESTSEDWESLAPGVDPTDYQPKDTPIIPPPPPPPPVD
SGRVPNLLSVSGKKDIEDNVHPVASTPTKKEGEAVVEEEEEKERLERERGPEDQKDGEGE
KDEDKTGKKDKSKDIKTLTQGHISARFSALIQKTWAGQFSAIVPQSFKTTLGLRYPQFSG
YRQQDCQEFLVLLLDCLHEDIINQFPLKSCMEKRDGSDNEGQVEETRSVITSTFQGQLKN
EVTCSVCGHVSVKCDPFVYLSVPIPHSNEQQITIFWSSVTGSSRSIEKLLVIIPILSTVN
DLKTSLCQLLEEGEGERGEEEDGGGGVSIVPDSVILAHVKEHSIVSTLGNALSIKHVIKD
EYKVYAFQVGSPPSTKAIPEVTATPQRDGYERITDDEVPMETDSSPRQPASEDGLPFKIP
RSDEADEATPLLEEAEPTVVVMEWHSCVICLEEMVDSELLTHSVCGAMICDTCLQASRNH
SGTENGLMPCPVCKSMVTLEEGFVPLAAPDKSDDIVRLLQLTVLFRNKVDDTWVLFGHPC
LLNVPASASIDKYYQLISPLLPEQCRQYPWSLALTDGKGRYCSRCLFGSGCGGCVLTNAM
TDVNLKPGDFFSISFTNLPSTVVQEADSFRSHSSLDSLWPSSVSLQDCLDLFSQKETLGQ
DNPWFCSKCNMNQTAVRQLLISQLPTTLIVHLKRFLFHGNTASKVETGVNFPLSLSLSSS
SSSAPTDYSLVSCVCHFGTLNSGHYTNYSKQPVSHKWYYYNDETVSEITPSDKDNESAYI
LFYHRQDSNTFDFPSKKDITFPTQEEELVELEPLLRALKPKPPPAPLPPPLPPIKKSSST
GNLAADTSDNDIQLQQQIAASLGLDIPAMSTPGPSPLKPSSSNPTLPAEQFSEPVVFKSA
HFKSFDAS
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcggatactggtgcagtggaagagtttatagcaaagagcaagaacctggctccagtt
caatcgcaggaatcaacctcagaagactgggagagtcttgccccaggggtagatcccact
gactaccagcccaaggacacgcccattatcccgccccctcctcctccccctcctgttgat
tccggtcgtgttcctaatttactttctgtttctgggaagaaagatatcgaagataatgtt
catcctgttgcctcaactccaactaagaaagaaggagaagctgtagtagaagaagaagaa
gaaaaagagagattagagagagaaaggggtcctgaggatcagaaagatggggaaggagag
aaagatgaggacaagactggtaaaaaagataaatctaaagacataaagacattaacacag
gggcacatcagtgctaggttttccgccttaatacagaagacttgggccggacagttctcg
gccattgtaccacagtcatttaaaacgacacttggacttcggtatccgcaatttagcggg
tatagacagcaagactgtcaggagtttttagttttattgctcgactgtcttcatgaagat
atcatcaaccagtttccattaaagagttgcatggagaagagagatggatcagataatgaa
ggccaagttgaggagactcgatctgtcattaccagcacatttcaaggacaattgaaaaat
gaagttacatgttcagtgtgtggtcatgtatcagttaagtgtgatccctttgtgtatctc
tcagttcctatccctcactctaatgaacagcaaataactattttctggtcttcagtaact
ggaagcagtagatcaattgaaaagttattggtcatcattccaatattgagtacagtcaat
gatctaaagacatctctctgtcagttactagaagaaggagaaggagagagaggagaagaa
gaagatggagggggtggtgtgtccatagtacccgatagtgtaatcttggctcatgttaaa
gaacactcaatagtatctactctaggtaatgcgttatccattaaacatgtcatcaaagat
gaatataaagtctatgcatttcaagttggttctcctcctagtactaaagcaatacctgaa
gttactgccactcctcaacgtgatggatatgaaagaattactgatgatgaagttcccatg
gaaactgactcctcccctcgacaaccagcctctgaagacggactcccttttaaaatccca
cgtagcgatgaagctgacgaggccacgcccctattagaagaggcggagccaacagtagtt
gttatggagtggcactcctgtgttatttgtttggaggagatggttgatagcgaattattg
acacactcagtttgtggagccatgatatgtgatacctgcttacaggcgtctcggaatcac
tctggaaccgagaatgggctcatgccgtgtccagtttgtaagtcaatggtgacactagag
gaaggttttgttcctctagcagctcctgataaatctgatgacattgttagattattacag
ttgactgttctctttcgcaataaagtcgatgatacttgggtcctctttggacacccttgt
cttctaaatgtaccagcgtcagcgagcattgataaatattatcagttgatatcacctttg
ttaccagagcagtgtcgccagtatccatggtcccttgctctgacggatggaaagggtcgg
tattgctcacgctgtctgtttggtagcggctgtggtgggtgtgtccttactaatgcaatg
actgacgtaaatctgaaaccaggagacttcttttctatctcattcactaacttaccatcc
actgtagtacaagaggccgactccttcaggtcccactcatctcttgatagtctttggccg
tcgtctgtttccctacaggactgccttgatcttttctctcaaaaggaaacgttgggacag
gacaacccttggttttgctcgaaatgcaatatgaatcagactgcagtgagacagttactg
atatcacagctaccaactacacttattgtccatcttaaaagattcttgtttcatggtaac
acagctagtaaggttgagaccggtgtcaatttccctctctccctctccctctcatcatct
tcatcttcagcaccaactgactactcacttgtcagctgtgtctgccattttggaacatta
aattccggtcattatactaattattctaaacagccagtctctcataagtggtattattac
aatgatgaaaccgtgtctgagataacaccatcagataaagataacgagagtgcctatata
ttgttctatcatagacaagattctaatactttcgattttccaagtaaaaaggacattact
tttccaactcaagaggaagaattggttgagctagagcctttactgagagccttaaaacct
aaaccaccacctgctcctcttccccctccccttcctccaatcaagaaatcctctagcaca
ggaaacttggctgccgacactagtgataatgatattcagctccagcagcagattgccgcc
tccctaggtcttgatataccagccatgtccactccaggtccttctcctttgaaaccttca
tcctctaacccgacactacctgcagaacagttttcagaaccagtggtttttaaatcagct
cattttaagagcttcgatgcatcatag

DBGET integrated database retrieval system