KEGG   Amphimedon queenslandica (sponge): 100632678Help
Entry
100632678         CDS       T02284                                 

Definition
thrombospondin-1-like
Orthology
K16857  
thrombospondin 1
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Phagosome
TGF-beta signaling pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100632678
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100632678
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100632678
Heparan sulfate/heparin binding proteins [BR:aqu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100632678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1025 aa AA seqDB search
MKSLLALSLFLALLGVLSASEETTHPTLTPETSDSHDFIVVGGQTCSVCTVIPQNGPVFP
LFAGNETVDPTNPCVTYKCVMPQVGGPQLLVINASNSCPPVHGLCQDGKPPYFVQGQCCK
GCHGNLFFISNPENGTSAPVPPNTWSSWSEWTQCSRTCGGGRQSRTRRCLTENQVQLDCS
GEVTQLQDCNTEVRCPVDGGWSDWTDWSDCSLTCGNGTRTRTRKCDNPAPLFGGAQCKGP
KEDTELCSLGHCPVDCEWREWQEWEPCSKSCGGGRQVRRRFYQPPQYGGKLCEGRAVQLQ
ECNAQHCPIDGGWTGWTDWSDCSQTCGGGESHRQRTCTNPAPQYGGKECVGSSNETKSCN
TQECPNPCKPNPCFRGSHCTILSDTEFQCAACPIGYSGDGVTCTQVNECQVASPCSSDPE
VFCFDLDPGYYCFNCPSGYVGTGKFGWSLADAANKQVCEDANECTNGQSKCHEHRECINT
RGSYQCGDCKPGYIAQGSYNCALENPCAAGVHNCMMDEYCINTNPGEYECQCPRGNIGNG
TQCSPDSDSDGIPDTALTTGCSKPGSASCKADNCKNKANSGQEDADGDGLGDACDPDIDN
DGITNHNDNCPRISNRDQRDTDRDHVGDACDNCVNVRNPSQEDLDEDGKGDQCDNDVDGD
NIPNSQDKCVRQKSTYSIRDTDRDGIGDDCDNCPYRRNRFQEDADQDGVGDACESTSDSD
KDGIQDGIDNCRNAPNADQLDTDGDGKGDACDDDDDNDGVKDTVDSCPKVHNPSDVLGNA
CANDCDGDGTPDADDVCPCNKNIDKTDFREHTIIALDPEGAEQVDPDWQFNDDGAEITQH
KNSDPGLLIGMDSFHSVLYTGTFFIEKNSDDDYAGFVFNYQSNKRFIVVMWKKTNQTYWI
SSPFEANAFAGIQVKVVDSNKGPSTHLRNALWRTGNTHAADHMVNVNTVWYDPNFYGWEY
DTGYAWELTYNGNKDCMRLKFYNGARMIVDTGCLCDMGLKGGRLGVFAFSQQNVIFSNLH
YECLS
NT seq 3076 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcttgctagcgttgagtttatttcttgctttgttgggtgtcctttcagctagt
gaagaaactacccatcctactcttactccagagacatcagactctcatgacttcatagtt
gttggaggccagacctgctcggtttgcactgtaatcccacagaatggtccagtttttcca
ttatttgctggtaacgaaacagtcgatcctactaacccatgtgttacatataaatgcgtg
atgcctcaagtaggaggtcctcagcttctagtcataaatgcaagtaattcctgtcctcct
gtccacgggctctgtcaagatggaaaacctccatattttgtgcagggccagtgctgcaaa
ggatgccatgggaacttgttcttcattagtaatccagagaatggaacatcagcaccagtt
cctcctaatacatggagttcatggtctgaatggacgcagtgcagcaggacttgcggtgga
ggacgtcaatcaagaacgagacgctgtctcaccgagaatcaagtgcagcttgactgcagt
ggtgaagtgacccaacttcaagactgcaacactgaagttagatgccctgttgatggaggt
tggtctgattggaccgactggtctgactgtagcttaacctgtgggaatggaactaggaca
agaacaaggaagtgtgacaaccctgctccgttattcggaggagctcaatgtaaaggaccc
aaagaagacactgaactttgctcacttggacactgccctgttgattgcgaatggagagag
tggcaggaatgggagccttgctccaagagttgtgggggcggacgtcaagtgaggagacga
ttctaccaaccacctcagtatggagggaaactatgtgaagggagagcagtccaactacaa
gaatgtaatgcccagcactgtccaattgatggtggttggactggttggactgattggagt
gactgtagtcagacttgtggtggaggtgaatcccatcgccagcgaacttgcactaaccca
gctcctcaatatggaggcaaggaatgtgtaggatcaagcaatgagacaaagtcatgcaat
acccaggaatgtcccaatccctgcaagcccaatccttgtttcagaggcagtcactgtact
atactgtctgatacagagttccaatgtgctgcctgtcctatcggctattctggggatggt
gtcacctgtactcaagtcaatgagtgtcaagttgcgtctccttgttccagtgatcctgaa
gtattctgttttgatcttgatccaggctactactgcttcaactgcccctctgggtacgtt
ggaaccggtaaatttggatggagtcttgctgatgccgccaacaaacaggtttgtgaagat
gctaacgagtgtaccaatggtcagtctaaatgtcatgaacacagagaatgtattaacacc
aggggttcttaccagtgtggtgactgtaagcctggttacatagctcagggtagctacaac
tgtgcactggagaatccctgtgctgctggagtacacaactgtatgatggatgagtactgt
atcaataccaaccctggggagtatgagtgccagtgtccaagaggtaacattggtaatggt
acccagtgtagtcctgattcagattccgatggtataccagacacagccctcaccactggt
tgctctaaacctggatcagcttcatgcaaagctgataattgtaagaataaagccaacagt
gggcaggaggatgctgatggtgatggattaggtgacgcctgtgatcctgatattgataat
gatggaatcactaatcacaatgataactgtccgagaatatcaaacagggatcagcgtgat
actgatcgggatcacgtcggtgatgcttgtgataactgcgttaacgtcaggaacccaagt
caagaagatcttgacgaagatgggaaaggagatcagtgtgacaatgacgtggatggagac
aatattcctaacagtcaggataagtgtgtaagacagaagagcacctacagtattagggac
actgatagagatgggattggagatgattgtgacaactgcccatacaggaggaatagattc
caagaagatgctgatcaagatggagtaggagacgcttgtgaatccacttctgattcagat
aaagacggcatacaagacggtattgataattgtcgcaacgctcctaatgctgaccagctg
gacactgatggcgatggtaaaggtgacgcctgtgatgatgatgatgacaatgatggagtg
aaggacactgtagactcctgccctaaagtacacaatcctagtgatgttcttggtaatgct
tgtgctaatgattgtgatggagatggtactcctgatgctgatgatgtctgtccttgtaat
aagaacattgataaaactgactttagagaacacaccatcatagccttggacccagaggga
gctgaacaggttgatcctgactggcagtttaatgatgatggagctgagatcactcaacac
aagaactcagatcctggtcttttgattggtatggacagtttccactcggtcctgtacact
ggaaccttcttcattgagaagaacagtgatgacgattacgctggttttgtgtttaactat
caaagcaacaaaaggtttatcgtagtcatgtggaagaagactaaccagacttattggatc
agtagtccgtttgaagctaatgcttttgctggcattcaagtcaaagtagtcgactctaat
aaaggacccagtactcaccttcgtaacgccttatggaggacagggaacactcatgctgcc
gatcacatggtcaatgtgaacactgtttggtacgaccctaacttctatggatgggagtat
gacactgggtatgcttgggaactgacttataatggaaacaaagactgtatgagactaaag
ttctacaatggtgctcgtatgatagtagacactggttgtctctgtgacatgggactcaaa
ggaggtagactgggagtgtttgccttctctcaacaaaacgtgatattctcaaaccttcat
tatgaatgtctctcag

DBGET integrated database retrieval system