KEGG   Amphimedon queenslandica (sponge): 100632678Help
Entry
100632678         CDS       T02284                                 

Definition
(RefSeq) cartilage oligomeric matrix protein-like isoform X1
  KO
K16857  
thrombospondin 1
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Phagosome
TGF-beta signaling pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100632678
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100632678
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100632678
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100632678
Cell adhesion molecules and their ligands [BR:aqu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100632678
Glycosaminoglycan binding proteins [BR:aqu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100632678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1090 aa AA seqDB search
MKSLLALSLFLALLGVLSASEETTHPTLTPETSDSHDFIVVGGQTCSVCTVIPQNGPVFP
LFAGNETVDPTNPCVTYKCVMPQVGGPQLLVINASNSCPPVHGLCQDGKPPYFVQGQCCK
GCHGNLFFISNPENGTSAPVPPNTWSSWSEWTQCSRTCGGGRQSRTRRCLTENQVQLDCS
GEVTQLQDCNTEVRCPVDGGWSDWTDWSDCSLTCGNGTRTRTRKCDNPAPLFGGAQCKGP
KEDTELCSLGHCPVDCEWREWQEWEPCSKSCGGGRQVRRRFYQPPQYGGKLCEGRAVQLQ
ECNAQHCPIDGGWTGWTDWSDCSQTCGGGESHRQRTCTNPAPQYGGSNCSGHHLELKECG
DIPCPVDCEWEEWSDWTECTVSCDGGMQYRSRNKTEAMHNGEECVGSSNETKSCNTQECP
NPCKPNPCFRGSHCTILSDTEFQCAACPIGYSGDGVTCTQVNECQVASPCSSDPEVFCFD
LDPGYYCFNCPSGYVGTGKFGWSLADAANKQVCEDANECTNGQSKCHEHRECINTRGSYQ
CGDCKPGYIAQGSYNCALENPCAAGVHNCMMDEYCINTNPGEYECQCPRGNIGNGTQCSP
DSDSDGIPDTALTTGCSKPGSASCKADNCKNKANSGQEDADGDGLGDACDPDIDNDGITN
HNDNCPRISNRDQRDTDRDHVGDACDNCVNVRNPSQEDLDEDGKGDQCDNDVDGDNIPNS
QDKCVRQKSTYSIRDTDRDGIGDDCDNCPYRRNRFQEDADQDGVGDACESTSDSDKDGIQ
DGIDNCRNAPNADQLDTDGDGKGDACDDDDDNDGVKDTVDSCPKVHNPSDVLGNACANDC
DGDGTPDADDVCPCNKNIDKTDFREHTIIALDPEGAEQVDPDWQFNDDGAEITQHKNSDP
GLLIGMDSFHSVLYTGTFFIEKNSDDDYAGFVFNYQSNKRFIVVMWKKTNQTYWISSPFE
ANAFAGIQVKVVDSNKGPSTHLRNALWRTGNTHAADHMVNVNTVWYDPNFYGWEYDTGYA
WELTYNGNKDCMRLKFYNGARMIVDTGCLCDMGLKGGRLGVFAFSQQNVIFSNLHYECLS
GAKQASQCAK
NT seq 3273 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcttgctagcgttgagtttatttcttgctttgttgggtgtcctttcagctagt
gaagaaactacccatcctactcttactccagagacatcagactctcatgacttcatagtt
gttggaggccagacctgctcggtttgcactgtaatcccacagaatggtccagtttttcca
ttatttgctggtaacgaaacagtcgatcctactaacccatgtgttacatataaatgcgtg
atgcctcaagtaggaggtcctcagcttctagtcataaatgcaagtaattcctgtcctcct
gtccacgggctctgtcaagatggaaaacctccatattttgtgcagggccagtgctgcaaa
ggatgccatgggaacttgttcttcattagtaatccagagaatggaacatcagcaccagtt
cctcctaatacatggagttcatggtctgaatggacgcagtgcagcaggacttgcggtgga
ggacgtcaatcaagaacgagacgctgtctcaccgagaatcaagtgcagcttgactgcagt
ggtgaagtgacccaacttcaagactgcaacactgaagttagatgccctgttgatggaggt
tggtctgattggaccgactggtctgactgtagcttaacctgtgggaatggaactaggaca
agaacaaggaagtgtgacaaccctgctccgttattcggaggagctcaatgtaaaggaccc
aaagaagacactgaactttgctcacttggacactgccctgttgattgcgaatggagagag
tggcaggaatgggagccttgctccaagagttgtgggggcggacgtcaagtgaggagacga
ttctaccaaccacctcagtatggagggaaactatgtgaagggagagcagtccaactacaa
gaatgtaatgcccagcactgtccaattgatggtggttggactggttggactgattggagt
gactgtagtcagacttgtggtggaggtgaatcccatcgccagcgaacttgcactaaccca
gctcctcaatatggaggcagcaactgctcgggacatcatctagaactgaaggagtgcggg
gatataccttgccctgttgattgtgaatgggaagaatggtcagattggacagagtgcact
gtatcatgtgatggcggcatgcaatatagatcaaggaataagacagaggctatgcacaat
ggagaggaatgtgtaggatcaagcaatgagacaaagtcatgcaatacccaggaatgtccc
aatccctgcaagcccaatccttgtttcagaggcagtcactgtactatactgtctgataca
gagttccaatgtgctgcctgtcctatcggctattctggggatggtgtcacctgtactcaa
gtcaatgagtgtcaagttgcgtctccttgttccagtgatcctgaagtattctgttttgat
cttgatccaggctactactgcttcaactgcccctctgggtacgttggaaccggtaaattt
ggatggagtcttgctgatgccgccaacaaacaggtttgtgaagatgctaacgagtgtacc
aatggtcagtctaaatgtcatgaacacagagaatgtattaacaccaggggttcttaccag
tgtggtgactgtaagcctggttacatagctcagggtagctacaactgtgcactggagaat
ccctgtgctgctggagtacacaactgtatgatggatgagtactgtatcaataccaaccct
ggggagtatgagtgccagtgtccaagaggtaacattggtaatggtacccagtgtagtcct
gattcagattccgatggtataccagacacagccctcaccactggttgctctaaacctgga
tcagcttcatgcaaagctgataattgtaagaataaagccaacagtgggcaggaggatgct
gatggtgatggattaggtgacgcctgtgatcctgatattgataatgatggaatcactaat
cacaatgataactgtccgagaatatcaaacagggatcagcgtgatactgatcgggatcac
gtcggtgatgcttgtgataactgcgttaacgtcaggaacccaagtcaagaagatcttgac
gaagatgggaaaggagatcagtgtgacaatgacgtggatggagacaatattcctaacagt
caggataagtgtgtaagacagaagagcacctacagtattagggacactgatagagatggg
attggagatgattgtgacaactgcccatacaggaggaatagattccaagaagatgctgat
caagatggagtaggagacgcttgtgaatccacttctgattcagataaagacggcatacaa
gacggtattgataattgtcgcaacgctcctaatgctgaccagctggacactgatggcgat
ggtaaaggtgacgcctgtgatgatgatgatgacaatgatggagtgaaggacactgtagac
tcctgccctaaagtacacaatcctagtgatgttcttggtaatgcttgtgctaatgattgt
gatggagatggtactcctgatgctgatgatgtctgtccttgtaataagaacattgataaa
actgactttagagaacacaccatcatagccttggacccagagggagctgaacaggttgat
cctgactggcagtttaatgatgatggagctgagatcactcaacacaagaactcagatcct
ggtcttttgattggtatggacagtttccactcggtcctgtacactggaaccttcttcatt
gagaagaacagtgatgacgattacgctggttttgtgtttaactatcaaagcaacaaaagg
tttatcgtagtcatgtggaagaagactaaccagacttattggatcagtagtccgtttgaa
gctaatgcttttgctggcattcaagtcaaagtagtcgactctaataaaggacccagtact
caccttcgtaacgccttatggaggacagggaacactcatgctgccgatcacatggtcaat
gtgaacactgtttggtacgaccctaacttctatggatgggagtatgacactgggtatgct
tgggaactgacttataatggaaacaaagactgtatgagactaaagttctacaatggtgct
cgtatgatagtagacactggttgtctctgtgacatgggactcaaaggaggtagactggga
gtgtttgccttctctcaacaaaacgtgatattctcaaaccttcattatgaatgtctctca
ggtgccaagcaagcttcacagtgcgccaaataa

DBGET integrated database retrieval system