KEGG   Amphimedon queenslandica (sponge): 100632748Help
Entry
100632748         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein LOC100632748
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100632748
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100632748
   00982 Drug metabolism - cytochrome P450
    100632748
Enzymes [BR:aqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100632748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 297 aa AA seqDB search
MDSFGFVILTGLCTAILHMYLAVNVGRARRKHGVPLPDQYSDTKKEFNCYQRAYMNTVEN
IPIFLMLLFAAGNKFPLISAGAGMIWIAGRVLYAHGYYTGDPEKRMRGAISYIGLLTLLV
CTLLNAVTRIGFLSNFFDWLDSYITLIVSEQFKMGGKLSLPKGDPFGYVILTGACSVVLH
AYLSVKVGMARRKHKIPLPDQYSADCVEFNCYQRAYMNMVEMYPVFLFVLFAGGDKYPRV
SAAAGMVWIAGRIAYAHGYYTGDPSKRNLGGFGVFGLLTLLGCTVANGVSRLGITSC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggattcctttggttttgttatccttactggcctttgcactgctattctgcacatgtat
cttgctgttaacgttggaagggcaagaaggaagcatggagtaccactgccagaccagtac
agtgacactaagaaagagttcaactgctaccaaagagcctacatgaacactgttgaaaat
atacccatctttcttatgctcctttttgctgctggcaacaagtttccactgattagtgct
ggagcaggcatgatctggatagctggtagggttttgtatgctcatggatactacactggc
gatcctgagaaacgtatgagaggagccatttcatacataggcctcttgacactgctagtc
tgcaccttgctgaatgctgtaacaaggattgggtttctttctaacttttttgattggtta
gatagttacataactttaattgtaagtgaacaattcaagatgggtggaaagcttagtttg
ccaaagggagacccttttggatatgtgatcctcaccggagcctgtagtgtggttcttcat
gcttatctctctgttaaagttggaatggctagaaggaagcacaagatcccactcccggat
cagtacagtgctgactgtgtagagtttaactgctaccagagagcttacatgaacatggtt
gaaatgtatcctgtttttttgtttgttttatttgctggaggagacaaatatcctagggta
agtgcagcagcaggcatggtgtggatagcaggcaggatagcctatgctcatggatattac
actggagatccaagtaaacgtaatcttggtgggtttggagtgtttggtttacttactcta
cttggatgcactgtggctaatggagtcagtcgtttaggcattacttcatgttga

DBGET integrated database retrieval system