KEGG   Amphimedon queenslandica (sponge): 100632820Help
Entry
100632820         CDS       T02284                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100632820
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100632820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 521 aa AA seqDB search
MAESEQECLDTVVKSGSVLAPWLGVNCTLLLKQDSLACVYPEATAAGSPPPLPIFAVKLE
DVVGLKILQDSPFSSSPSVCRAELCTYQKVKRFISSSYYRKFSTEILEFSDAKDFETNYK
TAKEWRESIQLQCRKNSRNLFVFSPEQIDRLEPMQLLVIINPFSGRKNGQKLFQNIARPM
FDLAVTNIINNVVVSFTASTERQGHAKEFVETFDLTSITGIVLASGDGIVYEVINGLMAR
PDWETAIKTPIGLIPTGSGNALVSSLLYEAEEESSLSLLFFSEEKAVIENAVFQIINGGI
QTHDIASVSTGSSHSYMGVLIHWALTGSVDVESEKLRILGGELRTIVGGLISIIMKRGYQ
GQLSYLPIDEESSVAATERDTSSGEAARPTTSISVSDPIPDNWKTIEGNFVMFIGLMLSH
MSDSIMGHSDIKIGSGEHRIVYAFDDVTRAQLLTGLVGSPNTAKYDTFHEIRTRAFRLNP
ISPGFITVDGELVDYGPIQVQVHPGMMRLYSRIKKCNQSLD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaagtgagcaagaatgccttgacacagtcgttaagtctggaagcgtactagca
ccatggctaggagttaactgcactcttctcctcaaacaagattcacttgcctgcgtctat
ccagaagctacagctgctggtagccctcctcctcttccaatttttgctgtgaaattagaa
gatgtcgttggcctaaagatactacaagactctcctttctcttccagcccaagcgtctgt
agagcagagctatgcacgtatcagaaagtgaagcgtttcatatcaagcagctactatcga
aaattctccacggaaattctagagttttcagatgcgaaggacttcgaaacaaactacaaa
acagcaaaagagtggagagagtccattcagctccagtgtaggaaaaacagcaggaatttg
tttgtcttttctcctgagcaaattgacagattagaaccaatgcaattgcttgttatcata
aacccattctccggtaggaagaacggccagaaactatttcaaaacattgctcgtccgatg
tttgacttagcagtcactaatatcatcaataatgttgttgtttcctttactgcgtcaaca
gagagacagggacatgctaaagagtttgtggaaacctttgatttgacgtctattactgga
attgtccttgcttcgggtgacgggattgtttatgaggttataaatggactaatggccagg
cctgactgggaaacagctataaagactccaattggactgatacctactggatcagggaat
gcactagtgtcatcactgctttatgaagccgaagaagaatcttctctctctctcttgttc
tttagtgaagagaaggcagtgatagagaacgctgtattccagattataaatggaggcatc
caaacgcatgacatagcctcagtctcgactggctcctcccactcatacatgggcgtactg
atacactgggcactgactggatcagtcgacgtagagtctgagaaattgagaatccttgga
ggtgaactccgtactatagtgggcgggctgataagcataattatgaagagaggttatcaa
ggccagctaagctacttacctattgatgaagaatcctcggtagctgctacagagagggat
acttctagtggagaagcagcaagaccaacgacaagtattagtgtttctgatcctatacct
gataactggaaaaccatcgaaggcaatttcgtgatgtttatcggtctaatgctatcacac
atgagtgactccataatgggtcattctgatattaagattggctcgggcgagcataggata
gtctatgctttcgatgacgtcacaagagcacagcttttaacgggcctagtcggctcgcct
aacactgctaaatacgacacatttcatgagattcgtacgagagcatttcgacttaatccg
atatctcctggctttataaccgtcgatggagagctggtagattacggtcctatacaagta
caagtccatcctggaatgatgagactttactcacgtattaagaaatgcaatcaatcactt
gactaa

DBGET integrated database retrieval system