KEGG   Amphimedon queenslandica (sponge): 100632946Help
Entry
100632946         CDS       T02284                                 

Definition
(RefSeq) sphingosine kinase 2-like isoform X1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100632946
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100632946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 504 aa AA seqDB search
MAESEQECLDTVVKSGSVLAPWLGVNCTLLLKQDSLACVYPEATAAGSPPPLPIFAVKLE
DVVGLKILQDSPFSSSPSVCRAELCTYQKVKRFISSSYYRKFSTEILEFSDAKDFETNYK
TAKEWRESIQLQCRKNSRNLFVFSPEQIDRLEPMQLLVIINPFSGRKNGQKLFQNIARPM
FDLAGAVIVQEVITERQGHAKEFVETFDLTSITGIVLASGDGIVYEVINGLMARPDWETA
IKTPIGLIPTGSGNALVSSLLYEADEEVHTCAIENAVFQIINGGIKQHDIASVCNSSSHS
YIGVVIHWGMTGIVDVESEKLRFLGGKLRNLIGGLVCIVMKRSYYGQLSYLPIEEDETKS
PLTEAEGSIHSTNTLKPTTDVGVSDPIPEHWKTIEGNFVIFMALTSSHVTENDMMCAETK
TGSGKFKILYTFDDVTRGQLLAKLSESTGAVKIENFHEIHTRAFRLNPISPCIITVDGEQ
IDYGPIQVQMHPGMMRLYSRVRCE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaagtgagcaagaatgccttgacacagtcgttaagtctggaagcgtactagca
ccatggctaggagttaactgcactcttctcctcaaacaagattcacttgcctgcgtctat
ccagaagctacagctgctggtagccctcctcctcttccaatttttgctgtgaaattagaa
gatgtcgttggcctaaagatactacaagactctcctttctcttccagcccaagcgtctgt
agagcagagctatgcacgtatcagaaagtgaagcgtttcatatcaagcagctactatcga
aaattctccacggaaattctagagttttcagatgcgaaggacttcgaaacaaactacaaa
acagcaaaagagtggagagagtccattcagctccagtgtaggaaaaacagcaggaatttg
tttgtcttttctcctgagcaaattgacagattagaaccaatgcaattgcttgttatcata
aacccattctccggtaggaagaacggccagaaactatttcaaaacattgctcgtccgatg
tttgacttagcaggtgctgttattgtccaagaggttattactgagagacagggacatgct
aaagagtttgtggaaacctttgatttgacgtctattactggaattgtccttgcttcgggt
gacgggattgtttatgaggttataaatggactaatggccaggcctgactgggaaacagct
ataaagactccaattggactgatacctactggatcagggaatgcactagtgtcatcactg
ctttatgaagccgatgaagaggtacacacgtgtgctatagagaatgcagtcttccagatt
atcaatggaggcataaagcaacatgatattgcctcggtttgtaacagctcctcccactca
tatataggagttgttattcactggggaatgaccggaatagtggacgttgagtctgagaaa
ctaaggtttttaggaggcaaattacgtaatttaataggagggctggtttgcatcgtaatg
aagaggtcgtactatggtcagttaagctatttgcctattgaagaagatgaaactaagtca
ccattaactgaagctgaaggcagcatacattctactaatactctcaaaccaacaacagat
gttggtgtttctgatccaatacccgagcactggaaaaccatcgaagggaactttgtcatt
tttatggctctcacatcatcgcacgtaacagagaacgatatgatgtgtgcggagacaaaa
accggctctggaaagtttaaaatcctttatacttttgatgacgttacaagaggccaactg
ctagcaaagttgtccgaaagtaccggtgcagtcaagatagagaattttcacgagattcat
acaagagcatttcgtcttaatccgatatctccgtgcatcataaccgtcgatggggaacag
atagactatggtcctatacaagtacagatgcatcctggaatgatgagactttactcgcgc
gtcaggtgtgagtag

DBGET integrated database retrieval system