KEGG   Amphimedon queenslandica (sponge): 100633042Help
Entry
100633042         CDS       T02284                                 

Definition
thymosin beta-12-like
Orthology
K05764  
thymosin, beta 4
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 41 aa AA seqDB search
MSDKPDVSEVTSFDKSKLKKTETQEKNPLPTKETIEQEKSS
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagcctgacgtatctgaagtaactagcttcgataagtctaagctgaagaaa
accgaaacccaggagaagaaccctcttccaactaaagagactatcgaacaagaaaagtct
tcttaa

DBGET integrated database retrieval system