KEGG   Amphimedon queenslandica (sponge): 100633163Help
Entry
100633163         CDS       T02284                                 

Gene name
Plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100633163 (Plcg1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100633163 (Plcg1)
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100633163 (Plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1259 aa AA seqDB search
MKALEAGTVMFKFRRKRPPEKRIFTLKLATFEIQQTPFPSRGRAIAEETVDVREIREVRE
SIESLDYRRAQDDLKVVDAQCCFVIFYGSEFRLKTLSVAAMCREERDAWLDGLRHIMNPN
NFQSPLLTMRWLKKKFFLLDRGNSVIGAVELKKFFQQVSHRGNMHKIRQIMQEHDSNQSG
VLAWDDFVRMYQTLIYDDQIGKHFHNYCADKTNFTFRELLAFFKDEQKDPRASDPTYVSN
FVWDFATSPGRDPRQPSLTLHEFVNFLFSKRNSIFNEEHATVYQDMDRPINHYWIASSHN
TYLTGNQYSSESSVEAYVRALRQGCRCIELDCWDGPDNSPIIFHGKTLTSKIKFTDVVQA
IKEHAFETSEYPVILSIEQHCDVSQQRFQANYFKQVFGDMLLVAPVSGTANNTLPSPNQL
KRKIIVKHKKLQTDDDVSASVTTAKADPADNDRVSDDLSFALRTGLLYMQDPINKKWSPH
FFVLTQDKLSFTEQEEKEEEDPEQVEEHELLPTEMHLKQPWFHGKLTRGRDDAEALLIDY
KDVQGAFLVRESATFAGDYSLSFTRDHKYNHVRIHTKSEGGKTKYYLIDHMLFDSIFELV
EHYRQFPLRSPQFEQILSTTVPRKDTHERQPWFNKNVSSKEAEDMLKRVRMDGAFLVRPS
GHGHDGARDDPHGRKTWAISFRADKKIRHCRFSEEGGQFTIGSATFDSMTELICYYEQNP
LYRRMKLKYAINEDILRQIGQDPDNSPYHSIYFTFNEEQSKTISVRAIFDYNAMMGDELS
FCRGAIITNVEKLEGGWWCGDYGKSTRGWFPANHVEEIKAEEAEELDEKQLGNLQQGAIN
IVGCKTEMSQQSATKIYVLKISPSTAIGHPGLEVSAETLEDLQNWKEAIDDASIKAKTIA
KKEHDKMNKLQRTQGIAQEMSDIVVYCQPTKAFTIDNPTKGKYYHMTSFVETRVERFVKN
KEHAGNFIQYSRLQLSRVYPKGQRIDSSNYDPIPMWCSGSQLVSLNYQTPDRPMQLNEGR
FLQNGRCGYVLMPDCMLYQEGFNPFDSNSHKTEPLNIVLTIIGARHLVKPGRGFASPLVE
VEVFGMPCDIAKNKTHQVDTNSFNPVWFSKFEFDINNPECALLRFVVQDLDVFGDPIDLG
QAVLPVTSLKTGYRSVILKNAYSEELELASLLVHLEFQKANEDEDLYCTIRSLQESIQQL
NSQMSVVANQYSDRDDRAKRQLEDMSDKMIHHQTQLRNLRDLRNKQQKRQQLQKTPSRL
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctagaggctgggacggtaatgtttaagttcagacgcaagaggccgccagag
aagagaatattcacactcaaactggccacatttgagatacagcagacaccctttccttct
cgtggtcgtgccatagctgaagaaacagttgatgtacgtgagatcagggaggttagggag
agtatagagtcactggattataggagggcccaggatgatcttaaggttgttgatgctcaa
tgctgctttgtcatattctatggatcagagtttcgtctaaagacactcagtgtagctgca
atgtgtagggaggaaagggacgcatggttagacggtctgaggcacattatgaatcctaac
aactttcaatcaccactcctcactatgagatggctcaagaagaagttctttttactggac
agaggaaattctgttattggagctgtagagttaaagaagttctttcagcaagtcagccat
cgtggtaatatgcacaaaattcgtcaaataatgcaggaacacgactccaaccagtcgggg
gtcttggcatgggacgattttgttcgtatgtaccagacccttatttatgacgaccagata
gggaagcactttcacaactattgcgctgacaagacaaacttcaccttcagagagctcctc
gctttcttcaaggacgagcagaaagaccccagagcttctgatccaacttatgtgtctaat
tttgtttgggactttgccacttcgcctggtcgggaccccagacaaccctcactgaccctc
catgagtttgtaaatttcctgttttccaagaggaactcgatattcaacgaagagcatgcc
acagtttatcaggacatggaccgtcccattaaccactactggatagcatcatcacacaac
acgtatttgactggtaatcagtattccagtgaatcatcagttgaagcttatgtcagagct
ctgagacaaggctgccgctgcattgagttggactgctgggatggtcctgataattctcca
atcatattccacgggaagactctcacgtcaaagataaagttcactgatgttgttcaggcg
atcaaagagcatgcgtttgagacctcagagtacccagtgatactctctatagagcagcac
tgtgacgtgtcacagcagaggtttcaagcaaactactttaaacaagtatttggagatatg
ttgctggttgctcctgtcagtggcactgctaataatacattaccatcacctaatcaactt
aagagaaaaataattgtcaaacataagaagttacagactgatgacgatgtttctgcatca
gtgactacagctaaagcagacccagctgataatgacagggtttctgatgatcttagcttt
gctttgaggacaggcttactttatatgcaagatcccatcaataaaaaatggtctcctcat
ttctttgtcctcactcaagataagctctccttcactgaacaggaagagaaagaggaggag
gatcctgaacaagttgaagagcacgaattattgcctacagaaatgcacctcaaacaacct
tggtttcatggaaagctcacaagaggcagagatgatgccgaggccttgcttattgattat
aaagatgttcaaggagctttccttgttagagaaagtgcaacatttgccggtgactactcg
ctatcattcactcgtgatcataagtataatcatgtgagaatacacactaagtctgaggga
gggaagactaagtactatctcattgaccacatgctctttgactcaatatttgaattggtg
gagcattatcgacagttcccattaaggagccctcaatttgagcaaatactcagcaccact
gtaccaaggaaggatactcacgagaggcagccttggttcaataagaacgtgtccagtaaa
gaggctgaggatatgctcaaaagagtgagaatggacggagctttcctcgtccgtccctct
ggtcatggacacgacggagccagggatgatcctcatgggagaaagacatgggccatcagc
ttcagagctgataagaagattcgtcactgcaggttcagtgaggaaggtggtcagttcacg
attgggtctgccacttttgacagcatgactgaactcatctgctactatgagcagaaccca
ctgtaccgtcgcatgaagctcaagtatgccatcaatgaggacattctcagacaaatagga
caggatcctgacaattctccatatcattcgatatacttcacattcaacgaagagcaatca
aaaacgatatcagtccgtgccatatttgactacaatgccatgatgggagatgagctctct
ttctgtcgcggtgccatcatcactaacgttgagaagctggagggaggctggtggtgtggg
gattacggtaagtccactcgcggctggttccctgctaaccacgttgaggagataaaggca
gaggaggcagaggagctggatgagaagcagctgggtaacctacagcaaggagccattaat
attgttggatgcaaaaccgaaatgagccagcagtcggctacaaagatttatgtgctcaag
atttctcctagcacggctattggtcaccccggccttgaagtatcagccgagacacttgaa
gacctccagaactggaaggaggctatcgatgacgcaagcattaaagcaaaaactattgca
aagaaagagcatgacaagatgaataagctacaaaggacccaagggatagcacaagaaatg
tcagacattgttgtgtactgccagccaacaaaagcattcaccattgacaatccaacaaaa
ggaaagtattaccacatgacgtcatttgtcgagacaagagtcgagagattcgtaaagaac
aaggaacacgctgggaactttatacaatactctcgtctccaattgagccgagtctatccc
aagggacagaggatcgactcttctaattatgacccaataccaatgtggtgctctggctca
caactagtctctcttaactatcaaactcctgatcgacccatgcaactcaatgaaggacgt
ttcctacagaatggaaggtgtggctatgtactaatgccagactgtatgttatatcaggaa
ggatttaatccctttgattcgaattcacataaaactgaaccacttaatattgtcctaaca
attattggtgcccgccacttagtgaagcctggacgtggtttcgcatctccactggttgag
gtggaagtgtttggcatgccttgtgacattgccaagaataaaacacatcaagttgacact
aacagtttcaatcccgtttggttctcgaaatttgaattcgacatcaacaaccccgagtgt
gccctcctgaggttcgtggtacaggatcttgacgtattcggtgatccgatcgaccttgga
caagccgtcctaccagtgacctccctcaagaccggctatcggtcggttatactcaagaac
gcctactctgaggagctggaactagctagtcttttagtccacttggaattccaaaaggct
aatgaagatgaagacctttattgtactataagatcgttgcaagagagtatacagcagctc
aactcacagatgagtgtggtcgccaaccagtacagtgacagggatgacagagctaagaga
cagcttgaggacatgtcggataaaatgatacaccatcagacgcagctaaggaacttgagg
gacctcagaaacaagcaacagaaaaggcagcagctgcaaaaaactccttcccgtttgtga

DBGET integrated database retrieval system